SitesBLAST
Comparing BPHYT_RS27915 FitnessBrowser__BFirm:BPHYT_RS27915 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
26% identity, 80% coverage: 45:396/439 of query aligns to 32:398/446 of A0A0H2VG78
- R102 (= R129) mutation to A: Loss of transport activity.
- I105 (≠ Q132) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E149) mutation to A: Loss of transport activity.
- Q137 (≠ S164) mutation to A: Loss of transport activity.
- Q250 (vs. gap) mutation to A: Loss of transport activity.
- Q251 (≠ Y260) mutation to A: Loss of transport activity.
- N256 (≠ Y265) mutation to A: Loss of transport activity.
- W357 (vs. gap) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
32% identity, 30% coverage: 76:205/439 of query aligns to 203:328/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
31% identity, 30% coverage: 76:205/439 of query aligns to 203:328/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
A1Z8N1 Facilitated trehalose transporter Tret1-1; DmTret1-1 from Drosophila melanogaster (Fruit fly) (see paper)
26% identity, 76% coverage: 85:416/439 of query aligns to 461:811/857 of A1Z8N1
Sites not aligning to the query:
- 248 modified: Phosphoserine
- 249 modified: Phosphoserine
- 250 modified: Phosphoserine
- 320 modified: Phosphoserine
- 322 modified: Phosphoserine
- 845 modified: Phosphoserine
- 846 modified: Phosphoserine
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
23% identity, 58% coverage: 129:381/439 of query aligns to 129:409/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
23% identity, 58% coverage: 129:381/439 of query aligns to 129:409/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
23% identity, 58% coverage: 129:381/439 of query aligns to 129:409/475 of 4gbyA
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
23% identity, 58% coverage: 129:381/439 of query aligns to 133:413/491 of P0AGF4
- R133 (= R129) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E149) mutation to A: Abolishes xylose transport.
- R160 (= R156) mutation to A: Abolishes xylose transport.
- Q168 (= Q168) binding ; mutation to A: Abolishes xylose transport.
- Q288 (≠ M254) mutation to A: Abolishes xylose transport.
- QQ 288:289 (≠ MT 254:255) binding
- Q289 (≠ T255) mutation to A: Strongly decreases xylose transport.
- N294 (≠ Y260) binding ; mutation to A: Abolishes xylose transport.
- Y298 (≠ V264) mutation to A: Abolishes xylose transport.
- N325 (= N292) mutation to A: No effect on xylose transport.
- G340 (= G307) mutation to A: Abolishes xylose transport.
- R341 (= R308) mutation R->A,W: Abolishes xylose transport.
- W392 (≠ V358) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E363) mutation to A: Abolishes xylose transport.
- R404 (= R370) mutation to A: Strongly decreases xylose transport.
Sites not aligning to the query:
- 24 F→A: Decreases xylose transport.
- 83 G→A: Abolishes xylose transport.
- 415 binding
- 416 W→A: Strongly decreases xylose transport.
Query Sequence
>BPHYT_RS27915 FitnessBrowser__BFirm:BPHYT_RS27915
MNPTEPIAATSSVSRSTRAAAVLRVTSGNFLEQFDFFLFGFYATFISKIFFPSTSEFASL
MLTFAVFGAGFLMRPLGAIFLGAYIDKVGRRMGLIVTLSIMASGTVLIACVPGYASIGLL
APALVLLGRLLQGFSAGAELGGVSVYLAEMATPGNRGFYTSWQSASQQVAIVMAAAIGYG
LNEWLSAQQIGAWGWRVPFLIGCAIVPFLFMLRRSLQETAAFEARQHHPQAREIFSMLLA
NWRIVIGGMLLTAMTTTTFYLITVYTPTFGRSVLKLSTADSLMVTLLVAVSNFVWLPIGG
AVSDRIGRKPLLLAVSVLAIFTAYPALSWLADAPSFARMLIVLLWFSFFFGMYNGAMVAA
LTEVMPAEVRVAGFSLAFSLATAVFGGFTPAVSTYLIQVTHDKAAPGYWLSFAALCGLCA
TLGLYRRRASSSASAASSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory