SitesBLAST
Comparing BPHYT_RS27950 FitnessBrowser__BFirm:BPHYT_RS27950 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q9CIV7 PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
38% identity, 90% coverage: 17:206/210 of query aligns to 18:192/192 of Q9CIV7
- D29 (= D28) binding
- D34 (= D33) binding
- D36 (= D35) binding
- HGAN 37:40 (≠ HIFN 36:39) binding
- AS 78:79 (≠ SS 77:78) binding
- R114 (= R117) mutation to A: Reduces activity 3-fold.; mutation to E: Reduces activity 100-fold.
- G115 (= G118) binding
- M124 (= M127) binding
- R161 (= R175) mutation to A: Loss of activity.
- Y164 (≠ F178) mutation to A: Reduces activity about 20-fold.
- DPG 174:176 (= DPG 188:190) binding
3cr3A Structure of a transient complex between dha-kinase subunits dham and dhal from lactococcus lactis (see paper)
38% identity, 90% coverage: 17:206/210 of query aligns to 18:192/192 of 3cr3A
- binding adenosine-5'-diphosphate: D29 (= D28), D34 (= D33), D36 (= D35), H37 (= H36), N40 (= N39), G77 (= G76), A78 (≠ S77), S79 (= S78), L82 (= L81), G115 (= G118), A117 (≠ T120), T123 (= T126), D174 (= D188), P175 (= P189), G176 (= G190)
- binding magnesium ion: D29 (= D28), D34 (= D33), D34 (= D33), D36 (= D35), D36 (= D35)
P76014 PEP-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 85% coverage: 20:198/210 of query aligns to 22:201/210 of P76014
4lrzA Crystal structure of the e.Coli dhar(n)-dhal complex (see paper)
37% identity, 85% coverage: 20:198/210 of query aligns to 23:202/211 of 4lrzA
- binding adenosine-5'-diphosphate: D31 (= D28), D36 (= D33), D38 (= D35), H39 (= H36), G79 (= G76), A80 (≠ S77), S81 (= S78), L84 (= L81), G122 (= G118), T130 (= T126), M131 (= M127), G178 (= G174), D192 (= D188), P193 (= P189), G194 (= G190)
- binding magnesium ion: D31 (= D28), D36 (= D33), D36 (= D33), D38 (= D35), D38 (= D35)
Q3LXA3 Triokinase/FMN cyclase; Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing); EC 2.7.1.28; EC 2.7.1.29; EC 4.6.1.15 from Homo sapiens (Human) (see 4 papers)
30% identity, 83% coverage: 17:190/210 of query aligns to 388:558/575 of Q3LXA3
- D401 (= D33) mutation to A: Abolishes both kinase and FMN cyclase activities.
- D403 (= D35) mutation to A: Abolishes both kinase and FMN cyclase activities.
- C404 (≠ H36) mutation to A: Decreases both kinase and FMN cyclase activities.
- G445 (= G76) to S: in TKFCD; very severe decrease of triokinase and glycerone kinase activities; dbSNP:rs1590578831
- S446 (= S77) mutation to A: Decreases both kinase and FMN cyclase activities.
- R543 (= R175) to I: in TKFCD; reduced protein levels in patient cells; very severe decrease of triokinase and glycerone kinase activities; dbSNP:rs547013163
- D556 (= D188) mutation to A: Abolishes both kinase and FMN cyclase activities.
Sites not aligning to the query:
- 112 T→A: Highly decreases kinase activity. No effect on FMN cyclase activity.
- 185 A → T: in dbSNP:rs2260655
- 204 K→A: Slightly decreases kinase activity. No effect on FMN cyclase activity.
- 221 H→A: Abolishes kinase activity but not FMN cyclase activity.
Query Sequence
>BPHYT_RS27950 FitnessBrowser__BFirm:BPHYT_RS27950
MNGKTVMACIDAAYAALKEHTDEIASLDQQIGDGDHIFNLLRGMEALLAVRAEIEAEAFG
PALDIAASKVLSTVGGSSGPLFFSLLNGMAKASAINAMDVAGFAHIFAAGVEAVGQRGKT
GVGSKTMMDVLIPVAKRFEELAAESAAARVVLDTLPQIAEENMLATRDMLATKGRASFLG
ERSRGHIDPGARSSQIMIASVCARLAQYNG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory