SitesBLAST
Comparing BPHYT_RS28135 FitnessBrowser__BFirm:BPHYT_RS28135 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
39% identity, 99% coverage: 4:337/339 of query aligns to 1:336/337 of P12311
- C38 (= C41) mutation to S: No activity.
- T40 (≠ S43) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (≠ L46) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
39% identity, 98% coverage: 4:336/339 of query aligns to 1:335/339 of 1rjwA
- active site: C38 (= C41), H39 (= H42), T40 (≠ S43), H43 (≠ L46), H61 (= H63), E62 (= E64), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), K110 (≠ L112), C148 (= C150), T152 (= T154), R331 (= R332)
- binding trifluoroethanol: T40 (≠ S43), C148 (= C150), I285 (≠ P286)
- binding zinc ion: C38 (= C41), H61 (= H63), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108)
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
39% identity, 98% coverage: 4:336/339 of query aligns to 1:335/336 of 6iqdA
- active site: C38 (= C41), T40 (≠ S43), H43 (≠ L46), H61 (= H63), C148 (= C150)
- binding zinc ion: C38 (= C41), H61 (= H63), E62 (= E64), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), C148 (= C150)
3piiA Crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide
39% identity, 98% coverage: 4:336/339 of query aligns to 1:335/337 of 3piiA
- active site: C38 (= C41), H39 (= H42), T40 (≠ S43), H43 (≠ L46), H61 (= H63), E62 (= E64), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), K110 (≠ L112), C148 (= C150), T152 (= T154), R331 (= R332)
- binding butyramide: T40 (≠ S43), H61 (= H63), W87 (= W89), C148 (= C150)
- binding zinc ion: C38 (= C41), H61 (= H63), E62 (= E64), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), C148 (= C150)
3s2fE Crystal structure of furx nadh:furfural
38% identity, 98% coverage: 4:336/339 of query aligns to 3:337/340 of 3s2fE
- active site: C40 (= C41), H41 (= H42), T42 (≠ S43), H45 (≠ L46), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), Q112 (≠ L112), C150 (= C150), T154 (= T154), R333 (= R332)
- binding furfural: T42 (≠ S43), W51 (= W52), H63 (= H63), W89 (= W89), C150 (= C150), I287 (≠ P286)
- binding nicotinamide-adenine-dinucleotide: C40 (= C41), H41 (= H42), T42 (≠ S43), C150 (= C150), T154 (= T154), G174 (= G174), G176 (= G176), G177 (= G177), L178 (= L178), D197 (≠ A197), I198 (≠ R198), K202 (= K202), T239 (= T238), A240 (≠ V239), V241 (≠ T240), N262 (≠ V261), G263 (= G262), L264 (= L263), I287 (≠ P286), V288 (≠ S287), R333 (= R332)
- binding zinc ion: C40 (= C41), H63 (= H63), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (= C150)
3s2fA Crystal structure of furx nadh:furfural
38% identity, 98% coverage: 4:336/339 of query aligns to 3:337/340 of 3s2fA
- active site: C40 (= C41), H41 (= H42), T42 (≠ S43), H45 (≠ L46), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), Q112 (≠ L112), C150 (= C150), T154 (= T154), R333 (= R332)
- binding phosphorylisopropane: T42 (≠ S43), H63 (= H63), W89 (= W89), I287 (≠ P286)
- binding zinc ion: C40 (= C41), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (= C150)
3s2eE Crystal structure of furx nadh complex 1
38% identity, 98% coverage: 4:336/339 of query aligns to 3:337/340 of 3s2eE
- active site: C40 (= C41), H41 (= H42), T42 (≠ S43), H45 (≠ L46), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), Q112 (≠ L112), C150 (= C150), T154 (= T154), R333 (= R332)
- binding nicotinamide-adenine-dinucleotide: C40 (= C41), H41 (= H42), T42 (≠ S43), C150 (= C150), T154 (= T154), G176 (= G176), G177 (= G177), L178 (= L178), D197 (≠ A197), I198 (≠ R198), K202 (= K202), T239 (= T238), A240 (≠ V239), V241 (≠ T240), S242 (= S241), A245 (= A244), N262 (≠ V261), G263 (= G262), L264 (= L263), I287 (≠ P286), V288 (≠ S287)
- binding zinc ion: C40 (= C41), H63 (= H63), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (= C150)
3s2eA Crystal structure of furx nadh complex 1
38% identity, 98% coverage: 4:336/339 of query aligns to 3:337/340 of 3s2eA
- active site: C40 (= C41), H41 (= H42), T42 (≠ S43), H45 (≠ L46), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), Q112 (≠ L112), C150 (= C150), T154 (= T154), R333 (= R332)
- binding zinc ion: C40 (= C41), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (= C150)
1lluA The ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate (see paper)
38% identity, 99% coverage: 2:336/339 of query aligns to 4:340/341 of 1lluA
- active site: C43 (= C41), H44 (= H42), T45 (≠ S43), H48 (≠ L46), H66 (= H63), E67 (= E64), C97 (= C94), C100 (= C97), C103 (= C100), C111 (= C108), Q115 (≠ L112), C153 (= C150), T157 (= T154), R336 (= R332)
- binding 1,2-ethanediol: H44 (= H42), T45 (≠ S43), L47 (≠ V45), D53 (≠ Q51), W92 (= W89), C153 (= C150)
- binding nicotinamide-adenine-dinucleotide: C43 (= C41), H44 (= H42), T45 (≠ S43), H48 (≠ L46), C153 (= C150), T157 (= T154), G179 (= G176), G180 (= G177), L181 (= L178), D200 (≠ A197), I201 (≠ R198), K205 (= K202), A243 (≠ V239), V244 (≠ T240), S245 (= S241), A248 (= A244), V265 (= V261), L267 (= L263), I290 (≠ P286), V291 (≠ S287), R336 (= R332)
- binding zinc ion: C43 (= C41), H66 (= H63), C100 (= C97), C103 (= C100), C111 (= C108), C153 (= C150)
Q8GIX7 Alcohol dehydrogenase; ADH; EC 1.1.1.1 from Moraxella sp. (strain TAE123) (see paper)
36% identity, 98% coverage: 4:336/339 of query aligns to 1:335/338 of Q8GIX7
- C38 (= C41) binding
- H61 (= H63) binding
- E62 (= E64) binding
- C92 (= C94) binding
- C95 (= C97) binding
- C98 (= C100) binding
- C106 (= C108) binding
- C148 (= C150) binding
4z6kA Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. Tae 123
36% identity, 98% coverage: 4:336/339 of query aligns to 1:335/345 of 4z6kA
- active site: C38 (= C41), H39 (= H42), T40 (≠ S43), H43 (≠ L46), H61 (= H63), E62 (= E64), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), Q110 (≠ L112), C148 (= C150), T152 (= T154), R331 (= R332)
- binding zinc ion: C38 (= C41), H61 (= H63), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), C148 (= C150)
3meqA Crystal structure of alcohol dehydrogenase from brucella melitensis
37% identity, 99% coverage: 2:336/339 of query aligns to 1:339/341 of 3meqA
- active site: C40 (= C41), H41 (= H42), T42 (≠ S43), H45 (≠ L46), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), L112 (= L112), C150 (= C150), T154 (= T154), R335 (= R332)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C40 (= C41), H41 (= H42), T42 (≠ S43), H45 (≠ L46), C150 (= C150), T154 (= T154), G176 (= G176), G177 (= G177), L178 (= L178), D197 (≠ A197), I198 (≠ R198), K202 (= K202), T241 (= T238), A242 (≠ V239), V243 (≠ T240), S244 (= S241), A247 (= A244), N264 (≠ V261), G265 (= G262), L266 (= L263), I289 (≠ P286), V290 (≠ S287)
- binding zinc ion: C40 (= C41), H63 (= H63), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (= C150)
6n7lC Crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1
35% identity, 99% coverage: 2:336/339 of query aligns to 6:341/344 of 6n7lC
- active site: C45 (= C41), T47 (≠ S43), H50 (≠ L46), H68 (= H63), C154 (= C150)
- binding nicotinamide-adenine-dinucleotide: C45 (= C41), H46 (= H42), T47 (≠ S43), H50 (≠ L46), C154 (= C150), T158 (= T154), G178 (= G174), G180 (= G176), G181 (= G177), L182 (= L178), D201 (≠ A197), V202 (≠ R198), K206 (= K202), T243 (= T238), A244 (≠ V239), V245 (≠ T240), S246 (= S241), A249 (= A244), N266 (≠ V261), G267 (= G262), L268 (= L263), I291 (≠ P286), V292 (≠ S287)
- binding zinc ion: C45 (= C41), H68 (= H63), C98 (= C94), C101 (= C97), C104 (= C100), C112 (= C108), C154 (= C150)
6z42A The low resolution structure of a zinc-dependent alcohol dehydrogenase from halomonas elongata.
35% identity, 99% coverage: 3:336/339 of query aligns to 3:334/336 of 6z42A
- active site: C41 (= C41), T43 (≠ S43), H46 (≠ L46), H64 (= H63), C148 (= C150)
- binding zinc ion: C41 (= C41), H64 (= H63), E65 (= E64), C95 (= C94), C98 (= C97), C101 (= C100), C109 (= C108), C148 (= C150)
P9WQC5 NADP-dependent alcohol dehydrogenase C; EC 1.1.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 99% coverage: 1:336/339 of query aligns to 1:342/346 of P9WQC5
- K209 (≠ D201) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P0CH37 NADP-dependent alcohol dehydrogenase C 2; Ms-ADHC 2; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 100% coverage: 1:339/339 of query aligns to 1:346/349 of P0CH37
- K210 (≠ D201) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P0CH36 NADP-dependent alcohol dehydrogenase C 1; Ms-ADHC 1; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 100% coverage: 1:339/339 of query aligns to 1:346/349 of P0CH36
- K210 (≠ D201) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
6c49A Crystal structure of alcohol dehydrogenase from acinetobacter baumannii
36% identity, 99% coverage: 2:336/339 of query aligns to 2:333/338 of 6c49A
P00331 Alcohol dehydrogenase 2; Alcohol dehydrogenase II; ADHII; YADH-2; EC 1.1.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 100% coverage: 2:339/339 of query aligns to 5:348/348 of P00331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
5yatA Crystal structure of mitochondrial alcohol dehydrogenase isozyme iii from komagataella phaffii gs115 (see paper)
34% identity, 99% coverage: 3:339/339 of query aligns to 5:347/347 of 5yatA
- active site: C43 (= C41), T45 (≠ S43), H48 (≠ L46), H66 (= H63), C153 (= C150)
- binding zinc ion: C43 (= C41), H66 (= H63), E67 (= E64), C97 (= C94), C100 (= C97), C103 (= C100), C111 (= C108), C153 (= C150)
Query Sequence
>BPHYT_RS28135 FitnessBrowser__BFirm:BPHYT_RS28135
MRTMKAVQVAKAGGPLELVERDVPEPGAGQVLIKIQACGICHSDVLTKEGQWPGLEYPRV
PGHEIAGVIDTVGAGVEGWAAGQRVGVGWHGGHCGRCEHCRRGDFVLCQRALVPGISYDG
GYAEFMVAPVEALARIPDDLSDVDAAPLLCAGITTFNALRNSGARAGDVVAVLGIGGLGH
LGVQFARKMGFVTVAIARGQDKASLAKELGAHHYIDSTTANVAQALQALGGARVILATVT
SGKAMSAVVGGLGLNGKLIMVGLSEEPVEVPIAQFIMGRNSVQGWPSGTSADSQDTLAFS
ALSGIKPMIEEFPLTKAAEAYDRMMSGAARFRVVLNTGQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory