Comparing BPHYT_RS28225 FitnessBrowser__BFirm:BPHYT_RS28225 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
2qlxA Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum in complex with l-rhamnose (see paper)
55% identity, 96% coverage: 1:103/107 of query aligns to 5:107/108 of 2qlxA
2qlwB Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum (see paper)
55% identity, 96% coverage: 1:103/107 of query aligns to 5:107/108 of 2qlwB
1x8dA Crystal structure of e. Coli yiil protein containing l-rhamnose (see paper)
42% identity, 93% coverage: 5:103/107 of query aligns to 5:103/104 of 1x8dA
P32156 L-rhamnose mutarotase; Rhamnose 1-epimerase; Type-3 mutarotase; EC 5.1.3.32 from Escherichia coli (strain K12) (see paper)
42% identity, 93% coverage: 5:103/107 of query aligns to 5:103/104 of P32156
7bywA Crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose- bound form) (see paper)
30% identity, 89% coverage: 10:104/107 of query aligns to 9:108/108 of 7bywA
>BPHYT_RS28225 FitnessBrowser__BFirm:BPHYT_RS28225
METIAFRMVLNPGMREEYERRHAQIWPELVDALHNAGVRDYRIFFDPDSNHLFAILTRNS
HHTMDELPQLDVMRKWWDYMADIMHTGPDHTPVQQPLEPVFHLNSLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory