SitesBLAST
Comparing BPHYT_RS28240 FitnessBrowser__BFirm:BPHYT_RS28240 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ekgA Crystal structure of l-rhamnonate dehydratase from azotobacter vinelandii complexed with mg and l-tartrate
82% identity, 99% coverage: 1:390/392 of query aligns to 2:393/395 of 3ekgA
- active site: K178 (= K177), P180 (= P179), G184 (= G183), S186 (≠ A185), E190 (≠ A189), D215 (= D214), W217 (= W216), E241 (= E240), T266 (≠ S265), G268 (= G267), E269 (= E268), Q290 (= Q289), D292 (= D291), H319 (= H318), E339 (= E338), D348 (= D347)
- binding magnesium ion: D215 (= D214), E241 (= E240), E269 (= E268)
3cxoB Crystal structure of l-rhamnonate dehydratase from salmonella typhimurium complexed with mg and 3-deoxy-l-rhamnonate (see paper)
62% identity, 99% coverage: 1:390/392 of query aligns to 2:400/402 of 3cxoB
- active site: Y52 (= Y44), K186 (= K177), P188 (= P179), G192 (= G183), H194 (≠ A185), A198 (= A189), D223 (= D214), W225 (= W216), E249 (= E240), T274 (≠ S265), G276 (= G267), E277 (= E268), Q297 (= Q289), D299 (= D291), H326 (= H318), E346 (= E338), S351 (≠ A343)
- binding (2R,4S)-2,4,7-trihydroxyheptanoic acid: H30 (= H22), I42 (= I34), R56 (= R48), K186 (= K177), P188 (= P179), D223 (= D214), W225 (= W216), E277 (= E268), H326 (= H318), E346 (= E338)
- binding magnesium ion: D223 (= D214), E249 (= E240), E277 (= E268)
3cxoA Crystal structure of l-rhamnonate dehydratase from salmonella typhimurium complexed with mg and 3-deoxy-l-rhamnonate (see paper)
62% identity, 99% coverage: 1:390/392 of query aligns to 2:400/402 of 3cxoA
- active site: Y52 (= Y44), K186 (= K177), P188 (= P179), G192 (= G183), H194 (≠ A185), A198 (= A189), D223 (= D214), W225 (= W216), E249 (= E240), T274 (≠ S265), G276 (= G267), E277 (= E268), Q297 (= Q289), D299 (= D291), H326 (= H318), E346 (= E338), S351 (≠ A343)
- binding 3,6-dideoxy-L-arabino-hexonic acid: W37 (= W29), R56 (= R48), K186 (= K177), D223 (= D214), W225 (= W216), E277 (= E268), H326 (= H318), E346 (= E338)
- binding magnesium ion: D223 (= D214), E249 (= E240), E277 (= E268)
3d46A Crystal structure of l-rhamnonate dehydratase from salmonella typhimurium complexed with mg and l-tartrate
62% identity, 99% coverage: 1:390/392 of query aligns to 5:403/405 of 3d46A
- active site: K189 (= K177), P191 (= P179), G195 (= G183), H197 (≠ A185), A201 (= A189), D226 (= D214), W228 (= W216), E252 (= E240), T277 (≠ S265), E280 (= E268), Q300 (= Q289), D302 (= D291), H329 (= H318), E349 (= E338), P362 (= P351)
- binding magnesium ion: D226 (= D214), E252 (= E240), E280 (= E268)
P77215 L-rhamnonate dehydratase; RhamD; EC 4.2.1.90 from Escherichia coli (strain K12) (see paper)
61% identity, 99% coverage: 1:390/392 of query aligns to 1:399/401 of P77215
- H29 (= H22) mutation to N: Loss of L-rhamnonate dehydratase activity due to absence of substrate binding.
- H277 (= H269) mutation to N: 35-fold decrease in L-rhamnonate dehydratase activity. 59-fold decrease in substrate affinity.
- H325 (= H318) mutation to N: Loss of L-rhamnonate dehydratase activity. 2-fold decrease in substrate affinity.
3fxgA Crystal structure of rhamnonate dehydratase from gibberella zeae complexed with mg
49% identity, 97% coverage: 3:382/392 of query aligns to 7:390/407 of 3fxgA
- active site: K184 (= K177), P186 (= P179), E196 (≠ A189), D221 (= D214), Y223 (≠ W216), E247 (= E240), G273 (= G267), E274 (= E268), Q295 (= Q289), D297 (= D291), H324 (= H318), E344 (= E338)
- binding magnesium ion: D221 (= D214), E247 (= E240), E274 (= E268)
3sqsA Crystal structure of a putative mandelate racemase/muconate lactonizing protein from dinoroseobacter shibae dfl 12
31% identity, 82% coverage: 59:381/392 of query aligns to 44:375/386 of 3sqsA
- active site: L62 (≠ T76), N65 (≠ E79), S147 (vs. gap), K173 (= K177), R175 (≠ P179), G177 (≠ Q181), G179 (= G183), K181 (≠ A185), A185 (= A189), E210 (≠ D214), Y212 (≠ W216), E236 (= E240), G261 (= G267), E262 (= E268), H263 (= H269), Q283 (= Q289), D285 (= D291), I307 (≠ V313), H312 (= H318), G314 (≠ S320), E332 (= E338), F337 (≠ A346)
- binding magnesium ion: E210 (≠ D214), E236 (= E240), E262 (= E268), Y347 (≠ T354), F350 (≠ L357), D351 (≠ L358)
3stpA Crystal structure of a putative galactonate dehydratase
31% identity, 82% coverage: 59:381/392 of query aligns to 48:379/390 of 3stpA
- active site: L66 (≠ T76), S69 (≠ E79), S151 (≠ A160), K177 (= K177), R179 (≠ P179), P189 (≠ A189), E214 (≠ D214), Y216 (≠ W216), E240 (= E240), G265 (= G267), E266 (= E268), H267 (= H269), Q287 (= Q289), D289 (= D291), I311 (≠ V313), H316 (= H318), E336 (= E338), F341 (≠ A346)
- binding magnesium ion: E214 (≠ D214), E240 (= E240), E266 (= E268)
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
31% identity, 82% coverage: 60:381/392 of query aligns to 23:341/351 of 5olcC
- active site: K148 (= K177), K150 (≠ P179), D178 (= D214), N180 (≠ W216), E204 (= E240), G229 (= G267), E230 (= E268), D253 (= D291), H280 (= H318), E304 (= E338), E309 (≠ A343)
- binding magnesium ion: D178 (= D214), E204 (= E240), E230 (= E268)
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
32% identity, 82% coverage: 59:381/392 of query aligns to 32:366/378 of 4hpnA
- active site: G50 (= G77), R53 (≠ I80), T134 (= T161), K164 (= K177), K166 (≠ P179), D194 (= D214), N196 (≠ W216), E220 (= E240), G245 (= G267), E246 (= E268), T247 (≠ H269), Q267 (= Q289), D269 (= D291), H296 (= H318), V297 (vs. gap), W298 (vs. gap), R320 (= R331), E329 (= E338), F330 (= F339), H334 (≠ V350)
- binding calcium ion: D194 (= D214), D209 (≠ Q229), E220 (= E240), G237 (≠ N257), E246 (= E268)
Sites not aligning to the query:
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
32% identity, 83% coverage: 59:383/392 of query aligns to 32:350/357 of 3ck5A
- active site: T50 (≠ A73), G137 (vs. gap), K164 (= K177), K166 (≠ P179), D195 (= D214), N197 (≠ W216), I220 (= I239), E221 (= E240), I243 (≠ V264), G246 (= G267), E247 (= E268), E268 (≠ Q289), D270 (= D291), H297 (= H318), G298 (= G319), V299 (≠ S320), Y315 (≠ F336), E317 (= E338)
- binding magnesium ion: D195 (= D214), E221 (= E240), E247 (= E268)
Sites not aligning to the query:
Q9RKF7 3,6-anhydro-alpha-L-galactonate cycloisomerase; AHGA cycloisomerase; EC 5.5.1.25 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
32% identity, 83% coverage: 59:383/392 of query aligns to 32:353/361 of Q9RKF7
- D195 (= D214) binding
- E221 (= E240) binding
- E247 (= E268) binding
2ox4C Crystal structure of putative dehydratase from zymomonas mobilis zm4
27% identity, 82% coverage: 68:390/392 of query aligns to 37:388/397 of 2ox4C
- active site: K165 (= K177), D167 (≠ P179), E214 (≠ D214), H216 (≠ W216), E240 (= E240), G265 (= G267), E266 (= E268), Q287 (= Q289), D289 (= D291), H316 (= H318), E341 (≠ A343)
- binding magnesium ion: E214 (≠ D214), E240 (= E240), E266 (= E268)
B0T0B1 D-mannonate dehydratase Caul1427; ManD; EC 4.2.1.8 from Caulobacter sp. (strain K31) (see paper)
28% identity, 85% coverage: 59:392/392 of query aligns to 19:387/403 of B0T0B1
- D211 (= D214) binding
- E237 (= E240) binding
- E263 (= E268) binding
4fi4A Crystal structure of mannonate dehydratase prk15072 (target efi- 502214) from caulobacter sp. K31
28% identity, 85% coverage: 59:392/392 of query aligns to 23:391/407 of 4fi4A
- active site: L41 (≠ T75), R44 (≠ G78), H127 (vs. gap), R152 (vs. gap), Q154 (vs. gap), Y164 (≠ M171), S187 (vs. gap), D215 (= D214), H217 (≠ W216), E241 (= E240), G266 (= G267), E267 (= E268), I268 (≠ H269), R288 (≠ Q289), T290 (≠ D291), C316 (≠ P317), H317 (= H318), G318 (= G319), A319 (≠ S320), E344 (= E338)
- binding magnesium ion: D215 (= D214), E241 (= E240), E267 (= E268)
Sites not aligning to the query:
3rcyF Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from roseovarius sp. Tm1035
26% identity, 85% coverage: 59:390/392 of query aligns to 24:379/397 of 3rcyF
- active site: K165 (vs. gap), D167 (vs. gap), R175 (≠ Q181), G208 (≠ D214), H210 (≠ W216), E234 (= E240), G259 (= G267), E260 (= E268), Q281 (= Q289), A283 (≠ D291), H310 (= H318), A313 (≠ S321), L332 (≠ P335), E335 (= E338)
- binding magnesium ion: E234 (= E240), E260 (= E268)
- binding alpha-D-ribofuranose: R85 (≠ G116), P86 (≠ R117), P239 (= P245), A266 (≠ W274), E267 (≠ G275)
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
27% identity, 84% coverage: 56:384/392 of query aligns to 57:381/395 of 2pp3A
- active site: S78 (≠ T75), K192 (= K177), A194 (= A185), D223 (= D214), N225 (≠ W216), E249 (= E240), G274 (= G267), E275 (= E268), D298 (= D291), H325 (= H318), E345 (= E338)
- binding l-glucaric acid: K79 (≠ T76), K192 (= K177), D223 (= D214), N225 (≠ W216), E275 (= E268), H325 (= H318), E345 (= E338), F347 (≠ L340)
- binding magnesium ion: D223 (= D214), E249 (= E240), E275 (= E268)
Sites not aligning to the query:
3nzgD Crystal structure of a putative racemase with mg ion
30% identity, 83% coverage: 57:383/392 of query aligns to 25:375/380 of 3nzgD
- active site: T138 (= T161), K161 (≠ G183), K171 (vs. gap), C173 (vs. gap), K177 (≠ E186), D205 (= D214), L207 (≠ C215), E232 (= E240), A257 (≠ M262), E258 (≠ M263), Q279 (= Q289), D281 (= D291), H308 (= H318), N309 (≠ G319), E333 (= E338), E338 (≠ M352)
- binding magnesium ion: D205 (= D214), E232 (= E240), E258 (≠ M263)
3bjsB Crystal structure of a member of enolase superfamily from polaromonas sp. Js666
26% identity, 85% coverage: 58:391/392 of query aligns to 30:367/376 of 3bjsB
- active site: P49 (≠ T76), S52 (≠ E79), L93 (≠ R117), G136 (≠ T161), K164 (= K177), R166 (≠ P179), D194 (= D214), N196 (≠ W216), E220 (= E240), G246 (= G267), E247 (= E268), N248 (≠ H269), Q268 (= Q289), D270 (= D291), H297 (= H318), S298 (≠ G319), S299 (= S320), E322 (≠ L340), C324 (≠ M342), K327 (= K345)
- binding magnesium ion: D194 (= D214), E220 (= E240), E247 (= E268)
Sites not aligning to the query:
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 84% coverage: 56:384/392 of query aligns to 60:384/398 of Q8ZL58
- KR 82:83 (≠ T- 76) binding
- K195 (= K177) binding
- K197 (≠ P179) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D214) binding
- N228 (≠ W216) binding
- E252 (= E240) binding
- E278 (= E268) binding
- H328 (= H318) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- E348 (= E338) binding
Sites not aligning to the query:
Query Sequence
>BPHYT_RS28240 FitnessBrowser__BFirm:BPHYT_RS28240
MAMPTIRHVRAFIVRGGGADYHDQPGGHWIDDHISTPMARYPEYRQSRQSFGINVLGTLV
VEIEASDGTVGFAVTTGGEIGAFIVEKHLARFLEGQLVTDIEKMWDQMYFSTLYYGRKGV
VLNTISGVDLALWDLLAKVRKEPVYQLLGGPVRDELVFYATGARPDLAKEMGFIGGKLPL
QHGPAEGEAGLKQNLEKLADMRSRVGDDFWLMYDCWMSLDVPYATRLAQAAHEYGLKWIE
ECLPPDDYWGYAELRRNVPRGMMVSTGEHEATRWGFRMLLEMQCCDLIQPDVGWCGGITE
LIKISALADAHNVMVVPHGSSVYSYHFVVTRHNSPFAEFLMMAPKADEVVPMFTPLLLDE
PVPVNGRMKVPDTPGFGVRLNPECALVRPYPR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory