SitesBLAST
Comparing BPHYT_RS28245 FitnessBrowser__BFirm:BPHYT_RS28245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
24% identity, 84% coverage: 18:388/442 of query aligns to 2:370/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
26% identity, 84% coverage: 18:388/442 of query aligns to 5:354/393 of 6e9oA
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
23% identity, 84% coverage: 18:388/442 of query aligns to 13:389/430 of P0AA76
- Y29 (≠ F32) binding
- D31 (= D34) mutation to N: Loss of galactonate transport activity.
- R32 (= R35) binding
- Y64 (= Y67) binding
- E118 (= E121) mutation to Q: Loss of galactonate transport activity.
- W358 (= W357) binding
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 48% coverage: 6:215/442 of query aligns to 74:286/534 of P53322
- K283 (≠ P212) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q9C0U9 Uncharacterized transporter PB1C11.03 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
22% identity, 52% coverage: 13:243/442 of query aligns to 91:327/570 of Q9C0U9
Sites not aligning to the query:
- 14 modified: Phosphoserine
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
22% identity, 37% coverage: 61:225/442 of query aligns to 113:273/495 of Q9NRA2
- K136 (≠ R84) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ I129) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ AV 144:145) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ LR 218:219) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ AALDE 220:224) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
- 328 G → E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- 334 P → R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- 371 G → V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Query Sequence
>BPHYT_RS28245 FitnessBrowser__BFirm:BPHYT_RS28245
MEAHAPVSLEAINSKVMRRLLPFLLLMYVLAFLDRANIGFAQKALQHDTGLSNAAFAFGA
GVFFIGYALFEVPSNLLLHRVGARVWMCRIMVTWGLVSAAMCLAHTPTAFYTLRFLLGVA
EAGFFPGVIYYLTHWFPQSARARAVGVFYFGAPLAFIFGSPLSGSLLELHGALGLTGWQW
LFLVEGALASAVGVWAFWYLDNRPEDARWLEPQERASLRAALDEDALLASAHGPHRILAA
LVDRRVLLLSAIYLLIQMSVYGVIFYLPQQVAAFLGTTVGLRVGLVAALPWLCALAVTWY
VPRRADRTGEHRRWAVVLLIVAGLGIGVSGLVHSPLFGLLALCCAASGFIAAQPLFWTFP
TRYLTGAAAAGGIALINSLGGLGGFIAPSLRTAAEHAFASTSAGLVVLGVSSLLAALLIG
TLLRRDPAQSRTTFETLLHRAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory