SitesBLAST
Comparing BPHYT_RS28480 FitnessBrowser__BFirm:BPHYT_RS28480 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
8w78A Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase in complex with fad and 2-oxoglutarate (see paper)
43% identity, 95% coverage: 16:394/398 of query aligns to 16:403/410 of 8w78A
- binding 2-oxoglutaric acid: S48 (= S48), H52 (= H52), Y245 (= Y243), F254 (= F252), L255 (= L253), H258 (= H256), R349 (= R347)
- binding flavin-adenine dinucleotide: E34 (= E34), K35 (= K35), H42 (= H42), Q43 (= Q43), S44 (≠ T44), N47 (= N47), S48 (= S48), V50 (= V50), H52 (= H52), V173 (= V172), G203 (= G201), G204 (= G202), Q206 (= Q204), R349 (= R347), P387 (= P378), G388 (≠ A379), A389 (= A380), T390 (= T381)
Sites not aligning to the query:
8w7fB Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion (see paper)
44% identity, 98% coverage: 3:394/398 of query aligns to 3:405/412 of 8w7fB
- binding flavin-adenine dinucleotide: G11 (= G11), I12 (= I12), V13 (= V13), E34 (= E34), K35 (= K35), H42 (= H42), Q43 (= Q43), S44 (≠ T44), H46 (= H46), N47 (= N47), S48 (= S48), V50 (= V50), H52 (= H52), V173 (= V172), G205 (= G201), G206 (= G202), Q208 (= Q204), Y231 (= Y227), V350 (≠ I346), R351 (= R347), P389 (= P378), G390 (≠ A379), A391 (= A380), T392 (= T381)
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
31% identity, 75% coverage: 4:303/398 of query aligns to 4:301/366 of 3dmeA
- binding flavin-adenine dinucleotide: I8 (= I8), G9 (= G9), G11 (= G11), V12 (≠ I12), V13 (= V13), E32 (= E34), A33 (≠ K35), T41 (≠ Q43), S42 (≠ T44), R44 (≠ H46), N45 (= N47), S46 (= S48), V48 (= V50), H50 (= H52), P170 (≠ Q171), L171 (≠ V172), A203 (≠ G201)
Sites not aligning to the query:
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
28% identity, 70% coverage: 2:278/398 of query aligns to 3:283/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G9), G12 (= G11), I14 (≠ V13), E33 (= E34), K34 (= K35), E41 (≠ H42), T42 (≠ Q43), S43 (≠ T44), A45 (≠ H46), N46 (= N47), S47 (= S48), V49 (= V50), H51 (= H52), E176 (≠ Q171), V177 (= V172), A209 (≠ G201), G210 (= G202), Y212 (≠ Q204), Y234 (= Y227)
- binding sn-glycerol-3-phosphate: S47 (= S48), H51 (= H52), K258 (≠ L253), G259 (= G254)
Sites not aligning to the query:
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
28% identity, 70% coverage: 2:278/398 of query aligns to 3:283/384 of P75063
Sites not aligning to the query:
- 346:347 binding
- 352 binding
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
24% identity, 57% coverage: 5:229/398 of query aligns to 4:226/827 of 3gsiA
- active site: H222 (≠ G225)
- binding flavin-adenine dinucleotide: G10 (= G11), I11 (= I12), V12 (= V13), D32 (≠ L33), Q33 (≠ E34), G41 (≠ H42), S42 (≠ Q43), T43 (= T44), H45 (= H46), P47 (≠ S48), L49 (≠ V50), T170 (≠ Q171), V171 (= V172), A200 (≠ G201), G201 (= G202), W203 (≠ Q204), H222 (≠ G225)
Sites not aligning to the query:
- active site: 256, 549
- binding flavin-adenine dinucleotide: 256, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 254, 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
24% identity, 57% coverage: 5:229/398 of query aligns to 4:226/827 of 1pj7A
- active site: H222 (≠ G225)
- binding flavin-adenine dinucleotide: G8 (= G9), G10 (= G11), I11 (= I12), V12 (= V13), D32 (≠ L33), Q33 (≠ E34), G41 (≠ H42), S42 (≠ Q43), T43 (= T44), H45 (= H46), P47 (≠ S48), L49 (≠ V50), T170 (≠ Q171), V171 (= V172), A200 (≠ G201), G201 (= G202), W203 (≠ Q204), H222 (≠ G225)
Sites not aligning to the query:
- active site: 256, 549
- binding flavin-adenine dinucleotide: 256, 331, 357, 358, 359, 360
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
24% identity, 57% coverage: 5:229/398 of query aligns to 5:227/828 of 1pj6A
- active site: H223 (≠ G225)
- binding flavin-adenine dinucleotide: G9 (= G9), G11 (= G11), I12 (= I12), V13 (= V13), D33 (≠ L33), Q34 (≠ E34), G42 (≠ H42), S43 (≠ Q43), T44 (= T44), H46 (= H46), P48 (≠ S48), L50 (≠ V50), V172 (= V172), A201 (≠ G201), G202 (= G202), W204 (≠ Q204), H223 (≠ G225)
Sites not aligning to the query:
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
24% identity, 57% coverage: 5:229/398 of query aligns to 7:229/830 of Q9AGP8
- IV 14:15 (= IV 12:13) binding
- DQ 35:36 (≠ LE 33:34) binding
- STSH 45:48 (≠ QTGH 43:46) binding
- L52 (≠ V50) binding
- V174 (= V172) binding
- H225 (≠ G225) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
Sites not aligning to the query:
- 259 Important for catalytic activity; binding ; Y→F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- 360:363 binding
- 539 binding
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
25% identity, 53% coverage: 6:216/398 of query aligns to 29:239/824 of Q8GAI3
- W66 (≠ G45) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (= H46) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
2uzzB X-ray structure of n-methyl-l-tryptophan oxidase (mtox) (see paper)
27% identity, 51% coverage: 1:202/398 of query aligns to 1:201/372 of 2uzzB
- active site: H44 (≠ S48), T47 (vs. gap), R48 (vs. gap), R51 (≠ I51), S97 (≠ L100)
- binding flavin-adenine dinucleotide: I8 (= I8), G11 (= G11), S12 (≠ I12), V13 (= V13), D32 (≠ E36), H38 (= H42), G41 (= G45), S42 (≠ H46), H43 (≠ N47), R48 (vs. gap), L49 (vs. gap), V172 (= V172), A200 (≠ G201), G201 (= G202)
Sites not aligning to the query:
- active site: 249, 259, 263, 308, 338, 341
- binding flavin-adenine dinucleotide: 220, 249, 308, 309, 310, 335, 337, 339, 340, 341
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
24% identity, 56% coverage: 6:227/398 of query aligns to 53:272/866 of Q9UI17
- CV 59:60 (≠ IV 12:13) binding
- EK 80:81 (= EK 34:35) binding
- 87:95 (vs. 42:50, 33% identical) binding
- H91 (= H46) modified: Tele-8alpha-FAD histidine
- H109 (vs. gap) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V172) binding
Sites not aligning to the query:
- 279 S → P: in dbSNP:rs532964
- 397:402 binding
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
24% identity, 56% coverage: 6:227/398 of query aligns to 9:228/824 of 4pabB
- active site: T53 (≠ I55), E102 (≠ R102), H226 (≠ G225)
- binding flavin-adenine dinucleotide: I11 (= I8), G12 (= G9), G14 (= G11), C15 (≠ I12), V16 (= V13), L35 (= L33), E36 (= E34), K37 (= K35), G43 (≠ H42), S44 (≠ Q43), T45 (= T44), H47 (= H46), A48 (≠ N47), A49 (≠ S48), G50 (= G49), L51 (≠ V50), V175 (= V172), A204 (≠ G201), G205 (= G202), W207 (≠ Q204), H226 (≠ G225), Y228 (= Y227)
Sites not aligning to the query:
- active site: 255, 536
- binding flavin-adenine dinucleotide: 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 56% coverage: 6:227/398 of query aligns to 46:265/857 of Q63342
- CV 52:53 (≠ IV 12:13) binding
- EK 73:74 (= EK 34:35) binding
- 80:88 (vs. 42:50, 33% identical) binding
- H84 (= H46) modified: Tele-8alpha-FAD histidine
- V212 (= V172) binding
- W244 (≠ Q204) binding
Sites not aligning to the query:
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
25% identity, 56% coverage: 3:226/398 of query aligns to 2:223/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I8), G8 (= G9), G10 (= G11), V11 (≠ I12), I12 (≠ V13), V30 (≠ L33), E31 (= E34), K32 (= K35), E38 (≠ H42), A39 (≠ Q43), S40 (≠ T44), A43 (≠ N47), G45 (= G49), L46 (≠ V50), V171 (= V172), G200 (= G201), G201 (= G202), W203 (≠ Q204)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS28480 FitnessBrowser__BFirm:BPHYT_RS28480
MTYDFCIIGGGIVGLATAMELLQREPTASLLLLEKETTLAKHQTGHNSGVIHAGIYYQPG
SLKAELCKRGAEATKQFCTEHAIPFDVCGKLLVASNPLELSRMEALYARSQQNGLRVERL
DAAELQRREPNIVGLGGLFLDATGIVDYRQVCEAMARVIEKAGGEIRLGTQVTSIAEVGD
YVTVGASDEQQWRAKKLVVCGGLQSDRLARLAGVKIDHQIVPFRGEYYRLPASKNDVVRH
LIYPIPDPDLPFLGVHLTRMIDGSVTVGPNAVLGFGRENYPKFSVNLRDVAEYAAFPGFW
KTIWRNLGSGMGEMKNSLFKRGYLEQCRKYCPSLTVDDLLPYEAGIRAQAVMRDGTLVHD
FLFADTPRMVHVCNAPSPAATSAMPIGSMIADRILKAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory