SitesBLAST
Comparing BPHYT_RS28490 FitnessBrowser__BFirm:BPHYT_RS28490 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
29% identity, 46% coverage: 21:232/461 of query aligns to 39:232/444 of Q8NLB7
- D54 (≠ E33) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D36) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R89) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
22% identity, 79% coverage: 76:437/461 of query aligns to 188:565/616 of P36035
- K338 (vs. gap) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 9 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
26% identity, 26% coverage: 78:199/461 of query aligns to 143:265/453 of 8sc2A
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 36% coverage: 70:236/461 of query aligns to 90:260/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
26% identity, 26% coverage: 78:199/461 of query aligns to 161:283/554 of O15245
- S189 (= S106) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ A145) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ P165) mutation to F: Decreased TEA uptake.
- P283 (= P199) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 160 L → F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- 287 R → G: in dbSNP:rs4646278
- 341 P → L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- 342 R → H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- 361 Y→F: Decreased TEA uptake.
- 376 Y→F: Decreased TEA uptake.
- 401 G → S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- 408 M → V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- 420 natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- 440 M → I: in dbSNP:rs35956182
- 461 V → I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- 465 G → R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; G→A: No changes in MPP(+) uptake.
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
8sc6A Human oct1 bound to thiamine in inward-open conformation (see paper)
26% identity, 74% coverage: 78:420/461 of query aligns to 143:438/447 of 8sc6A
8et8A Cryo-em structure of the organic cation transporter 1 in complex with verapamil (see paper)
27% identity, 26% coverage: 78:199/461 of query aligns to 160:282/532 of 8et8A
Sites not aligning to the query:
- binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: 31, 35, 353, 360, 378, 381, 385, 449, 469
8et7A Cryo-em structure of the organic cation transporter 1 in complex with diphenhydramine (see paper)
27% identity, 26% coverage: 78:199/461 of query aligns to 160:282/532 of 8et7A
Sites not aligning to the query:
8sc3A Human oct1 bound to fenoterol in inward-open conformation (see paper)
27% identity, 23% coverage: 78:183/461 of query aligns to 143:240/445 of 8sc3A
Sites not aligning to the query:
Query Sequence
>BPHYT_RS28490 FitnessBrowser__BFirm:BPHYT_RS28490
MNTSPVSSGNAPVISRSAVNRVLAASVVGTAIEWYDFFLYATASALVFAKLFFPSFDPVV
GTIAAFGSFAVGYVARPFGAVFFGHFGDRIGRKATLVATLTIMGVSTFVIGLLPTYASIG
VWAPILLVAMRFMQGLGVGGEWGGAVLMVVETAPARKRGFFGAFPQLGVPLGLMLSTAVF
KAVSSMPSDAFYSWGWRLPFLLSVALIAIGLFIRLRVMESPVFEQIKASKQVVKAPLVEL
LRRHPKDLVLTIGTRFAVDITFNVINVFVLVYGTTRLGLSRGLLLNAIIVGCAFALITLP
LFGKLSDVIGRRTVFMLGAVFVAIYGFAFFPLLETRNPTLIFVAYVCGIALSQASVYGVQ
STWFAELFGTRVRYTGASLPYQIAGIITSGPTPLIATYLFATYGQTLPISIYIAATGLLS
LVCAFFLAETFRRDLSAEPEDEAAAAPGARASAHSPHPLTR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory