SitesBLAST
Comparing BPHYT_RS28620 FitnessBrowser__BFirm:BPHYT_RS28620 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
39% identity, 98% coverage: 5:258/260 of query aligns to 1:249/257 of 6slbAAA
- active site: Q64 (≠ G65), F69 (≠ M70), L80 (≠ F83), N84 (≠ S87), A108 (≠ L117), S111 (≠ D120), A130 (≠ S139), F131 (≠ Y140), L136 (= L145), P138 (= P147), D139 (= D148), A224 (= A233), G234 (≠ Y243)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ K59), A62 (= A63), Q64 (≠ G65), D65 (= D66), L66 (≠ V67), Y76 (≠ G79), A108 (≠ L117), F131 (≠ Y140), D139 (= D148)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
38% identity, 94% coverage: 14:258/260 of query aligns to 10:237/245 of 6slaAAA
- active site: Q61 (≠ G65), L68 (≠ Q89), N72 (≠ H93), A96 (≠ L117), S99 (≠ D120), A118 (≠ S139), F119 (≠ Y140), L124 (= L145), P126 (= P147), N127 (≠ D148), A212 (= A233), G222 (≠ Y243)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ R25), A59 (= A63), Q61 (≠ G65), D62 (= D66), L63 (≠ V67), L68 (≠ Q89), Y71 (≠ V92), A94 (= A115), G95 (= G116), A96 (≠ L117), F119 (≠ Y140), I122 (≠ R143), L124 (= L145), N127 (≠ D148), F234 (= F255), K237 (= K258)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
33% identity, 99% coverage: 1:258/260 of query aligns to 1:251/259 of 5zaiC
- active site: A65 (≠ G65), F70 (≠ M70), S82 (≠ Q89), R86 (≠ H93), G110 (≠ L117), E113 (≠ D120), P132 (≠ S139), E133 (≠ Y140), I138 (≠ L145), P140 (= P147), G141 (≠ D148), A226 (= A233), F236 (≠ Y243)
- binding coenzyme a: K24 (= K24), L25 (≠ R25), A63 (= A63), G64 (= G64), A65 (≠ G65), D66 (= D66), I67 (≠ V67), P132 (≠ S139), R166 (≠ K173), F248 (= F255), K251 (= K258)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
33% identity, 99% coverage: 1:258/260 of query aligns to 1:249/255 of 3q0jC
- active site: A65 (≠ G65), M70 (= M70), T80 (≠ E80), F84 (≠ N84), G108 (≠ L117), E111 (≠ D120), P130 (≠ S139), E131 (≠ Y140), V136 (≠ L145), P138 (= P147), G139 (≠ D148), L224 (≠ A233), F234 (≠ Y243)
- binding acetoacetyl-coenzyme a: Q23 (≠ E23), A24 (≠ K24), L25 (≠ R25), A27 (= A27), A63 (= A63), G64 (= G64), A65 (≠ G65), D66 (= D66), I67 (≠ V67), K68 (≠ G68), M70 (= M70), F84 (≠ N84), G107 (= G116), G108 (≠ L117), E111 (≠ D120), P130 (≠ S139), E131 (≠ Y140), P138 (= P147), G139 (≠ D148), M140 (≠ G149)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
33% identity, 99% coverage: 1:258/260 of query aligns to 1:249/255 of 3q0gC
- active site: A65 (≠ G65), M70 (= M70), T80 (≠ E80), F84 (≠ N84), G108 (≠ L117), E111 (≠ D120), P130 (≠ S139), E131 (≠ Y140), V136 (≠ L145), P138 (= P147), G139 (≠ D148), L224 (≠ A233), F234 (≠ Y243)
- binding coenzyme a: L25 (≠ R25), A63 (= A63), I67 (≠ V67), K68 (≠ G68), Y104 (≠ A113), P130 (≠ S139), E131 (≠ Y140), L134 (≠ R143)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
33% identity, 95% coverage: 13:258/260 of query aligns to 12:248/256 of 3h81A
- active site: A64 (≠ G65), M69 (= M70), T79 (≠ E80), F83 (≠ N84), G107 (≠ L117), E110 (≠ D120), P129 (≠ S139), E130 (≠ Y140), V135 (≠ L145), P137 (= P147), G138 (≠ D148), L223 (≠ A233), F233 (≠ Y243)
- binding calcium ion: F233 (≠ Y243), Q238 (≠ H248)
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
37% identity, 93% coverage: 18:258/260 of query aligns to 19:253/261 of 5jbxB
- active site: A67 (≠ G65), R72 (= R73), L84 (vs. gap), R88 (≠ S87), G112 (≠ L117), E115 (≠ D120), T134 (≠ S139), E135 (≠ Y140), I140 (≠ L145), P142 (= P147), G143 (≠ D148), A228 (= A233), L238 (≠ Y243)
- binding coenzyme a: S24 (≠ E23), R25 (≠ K24), R26 (= R25), A28 (= A27), A65 (= A63), D68 (= D66), L69 (≠ M70), K70 (≠ A71), L110 (≠ A115), G111 (= G116), T134 (≠ S139), E135 (≠ Y140), L138 (≠ R143), R168 (≠ K173)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
33% identity, 95% coverage: 13:258/260 of query aligns to 12:244/250 of 3q0gD
- active site: A64 (≠ G65), M69 (= M74), T75 (≠ E80), F79 (≠ N84), G103 (≠ L117), E106 (≠ D120), P125 (≠ S139), E126 (≠ Y140), V131 (≠ L145), P133 (= P147), G134 (≠ D148), L219 (≠ A233), F229 (≠ Y243)
- binding Butyryl Coenzyme A: F225 (≠ Q239), F241 (= F255)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
32% identity, 99% coverage: 4:260/260 of query aligns to 1:254/260 of 2hw5C
- active site: A68 (≠ G65), M73 (= M74), S83 (≠ R88), L87 (≠ V92), G111 (≠ L117), E114 (≠ D120), P133 (≠ S139), E134 (≠ Y140), T139 (≠ L145), P141 (= P147), G142 (≠ D148), K227 (≠ Q237), F237 (vs. gap)
- binding crotonyl coenzyme a: K26 (≠ E23), A27 (≠ K24), L28 (≠ R25), A30 (= A27), K62 (= K59), I70 (≠ V67), F109 (≠ A115)
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
32% identity, 96% coverage: 11:260/260 of query aligns to 13:248/254 of 2dubA
- active site: A67 (≠ G65), M72 (= M74), S82 (≠ N84), G105 (≠ L117), E108 (≠ D120), P127 (≠ S139), E128 (≠ Y140), T133 (≠ L145), P135 (= P147), G136 (≠ D148), K221 (≠ Q237), F231 (vs. gap)
- binding octanoyl-coenzyme a: K25 (≠ E23), A26 (≠ K24), L27 (≠ R25), A29 (= A27), A65 (= A63), A67 (≠ G65), D68 (= D66), I69 (≠ V67), K70 (= K72), G105 (≠ L117), E108 (≠ D120), P127 (≠ S139), E128 (≠ Y140), G136 (≠ D148), A137 (≠ G149)
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
31% identity, 99% coverage: 4:260/260 of query aligns to 1:252/258 of 1mj3A
- active site: A68 (≠ G65), M73 (= M74), S83 (≠ N84), L85 (≠ W86), G109 (≠ L117), E112 (≠ D120), P131 (≠ S139), E132 (≠ Y140), T137 (≠ L145), P139 (= P147), G140 (≠ D148), K225 (≠ Q237), F235 (vs. gap)
- binding hexanoyl-coenzyme a: K26 (≠ E23), A27 (≠ K24), L28 (≠ R25), A30 (= A27), A66 (= A63), G67 (= G64), A68 (≠ G65), D69 (= D66), I70 (≠ V67), G109 (≠ L117), P131 (≠ S139), E132 (≠ Y140), L135 (≠ R143), G140 (≠ D148)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
32% identity, 99% coverage: 4:260/260 of query aligns to 1:254/260 of 1dubA
- active site: A68 (≠ G65), M73 (= M70), S83 (≠ A78), L87 (≠ F83), G111 (≠ L117), E114 (≠ D120), P133 (≠ S139), E134 (≠ Y140), T139 (≠ L145), P141 (= P147), G142 (≠ D148), K227 (≠ Q237), F237 (vs. gap)
- binding acetoacetyl-coenzyme a: K26 (≠ E23), A27 (≠ K24), L28 (≠ R25), A30 (= A27), A66 (= A63), A68 (≠ G65), D69 (= D66), I70 (≠ V67), Y107 (≠ A113), G110 (= G116), G111 (≠ L117), E114 (≠ D120), P133 (≠ S139), E134 (≠ Y140), L137 (≠ R143), G142 (≠ D148), F233 (≠ Y243), F249 (= F255)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
32% identity, 96% coverage: 11:260/260 of query aligns to 12:252/258 of 1ey3A
- active site: A66 (≠ G65), M71 (= M70), S81 (≠ A78), L85 (≠ F83), G109 (≠ L117), E112 (≠ D120), P131 (≠ S139), E132 (≠ Y140), T137 (≠ L145), P139 (= P147), G140 (≠ D148), K225 (≠ Q237), F235 (vs. gap)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ E23), L26 (≠ R25), A28 (= A27), A64 (= A63), G65 (= G64), A66 (≠ G65), D67 (= D66), I68 (≠ V67), L85 (≠ F83), W88 (= W86), G109 (≠ L117), P131 (≠ S139), L135 (≠ R143), G140 (≠ D148)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
31% identity, 99% coverage: 4:260/260 of query aligns to 31:284/290 of P14604
- E144 (≠ D120) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ Y140) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
5ducA Crystal structure of m. Tuberculosis echa6 bound to ligand gsk951a (see paper)
37% identity, 83% coverage: 6:221/260 of query aligns to 3:201/244 of 5ducA
- active site: A61 (≠ G65), D66 (≠ M70), P73 (= P77), I77 (≠ Q90), A101 (≠ L117), Q104 (≠ D120), P123 (≠ S139), T124 (≠ Y140), L129 (= L145), L131 (≠ P147), D132 (= D148)
- binding (5R,7S)-N-(1,3-benzodioxol-5-ylmethyl)-5-(4-ethylphenyl)-7-(trifluoromethyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide: L76 (≠ Q89), H80 (= H93), D84 (≠ N97), Q104 (≠ D120), D132 (= D148), W134 (≠ G150)
Sites not aligning to the query:
5du4A Crystal structure of m. Tuberculosis echa6 bound to ligand gsk366a (see paper)
37% identity, 83% coverage: 6:221/260 of query aligns to 3:201/244 of 5du4A
- active site: A61 (≠ G65), D66 (≠ M70), P73 (= P77), I77 (≠ Q90), A101 (≠ L117), Q104 (≠ D120), P123 (≠ S139), T124 (≠ Y140), L129 (= L145), L131 (≠ P147), D132 (= D148)
- binding (5R,7S)-5-(4-ethylphenyl)-N-(4-methoxybenzyl)-7-(trifluoromethyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide: L76 (≠ Q89), I77 (≠ Q90), H80 (= H93), D84 (≠ N97), Q104 (≠ D120), D132 (= D148), W134 (≠ G150)
Sites not aligning to the query:
5dtwA Crystal structure of m. Tuberculosis echa6 bound to c20-coa (see paper)
37% identity, 83% coverage: 6:221/260 of query aligns to 3:201/244 of 5dtwA
- active site: A61 (≠ G65), D66 (≠ M70), P73 (= P77), I77 (≠ Q90), A101 (≠ L117), Q104 (≠ D120), P123 (≠ S139), T124 (≠ Y140), L129 (= L145), L131 (≠ P147), D132 (= D148)
- binding Arachinoyl-CoA: R18 (= R21), E20 (= E23), R21 (≠ K24), R21 (≠ K24), R22 (= R25), A24 (= A27), A59 (= A63), A61 (≠ G65), D62 (= D66), L63 (≠ V67), H80 (= H93), D84 (≠ N97), G100 (= G116), A101 (≠ L117), Y127 (≠ R143), W134 (≠ G150)
Sites not aligning to the query:
5dufA Crystal structure of m. Tuberculosis echa6 bound to ligand gsk729a (see paper)
37% identity, 83% coverage: 6:221/260 of query aligns to 4:202/245 of 5dufA
- active site: A62 (≠ G65), D67 (≠ M70), P74 (= P77), I78 (≠ Q90), A102 (≠ L117), Q105 (≠ D120), P124 (≠ S139), T125 (≠ Y140), L130 (= L145), L132 (≠ P147), D133 (= D148)
- binding (5R,7S)-5-(4-ethylphenyl)-7-(trifluoromethyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxylic acid: L77 (≠ Q89), I78 (≠ Q90), H81 (= H93), D85 (≠ N97), Q105 (≠ D120), D133 (= D148), W135 (≠ G150)
Sites not aligning to the query:
Q62651 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial; EC 5.3.3.- from Rattus norvegicus (Rat) (see paper)
36% identity, 80% coverage: 5:213/260 of query aligns to 56:271/327 of Q62651
- D176 (= D120) mutation D->A,D: Strongly decreases dienoyl-CoA and trienoyl-CoA isomerase activity.
- E196 (≠ Y140) mutation E->D,Q: Strongly decreases dienoyl-CoA and trienoyl-CoA isomerase activity.
- D204 (= D148) mutation D->A,N: Strongly decreases dienoyl-CoA and trienoyl-CoA isomerase activity.
5du6A Crystal structure of m. Tuberculosis echa6 bound to ligand gsk059a. (see paper)
37% identity, 83% coverage: 6:221/260 of query aligns to 3:199/242 of 5du6A
- active site: A61 (≠ G65), P71 (= P77), I75 (≠ Q90), A99 (≠ L117), Q102 (≠ D120), P121 (≠ S139), T122 (≠ Y140), L127 (= L145), L129 (≠ P147), D130 (= D148)
- binding (5R,7R)-5-(4-ethylphenyl)-N-(4-fluorobenzyl)-7-methyl-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide: L74 (≠ Q89), D82 (≠ N97), D130 (= D148), W132 (≠ G150)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS28620 FitnessBrowser__BFirm:BPHYT_RS28620
MGTSNIEVTITSRIATITLNRPEKRNAISDDMRTELIEALNRVSTDPEVRAVVLTGSGKG
FCAGGDVGGMAKRMEAPAGEVAFNGWSRQQRVHHTVNLLFSMPKPTIAAVNGAAAGLGAD
MALSCDFVVASEEASFAWSYIKRGLIPDGGGMYFLPRRVGLSRAKELIFSGRKVEAPEAL
ALGIADRVSRSDALLADAQAWAEELAQGSPTALALGKSILNQSYELSAHQVFAQGSQAQA
VCYTSHEHRESVLAFLNKSR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory