Comparing BPHYT_RS28880 FitnessBrowser__BFirm:BPHYT_RS28880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
1gttA Crystal structure of hpce (see paper)
57% identity, 81% coverage: 44:246/252 of query aligns to 223:417/421 of 1gttA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
37% identity, 86% coverage: 27:243/252 of query aligns to 45:247/252 of 3qdfA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
37% identity, 85% coverage: 34:246/252 of query aligns to 80:303/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
37% identity, 83% coverage: 34:243/252 of query aligns to 81:301/303 of 8sutA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
35% identity, 82% coverage: 32:237/252 of query aligns to 58:272/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
35% identity, 82% coverage: 32:237/252 of query aligns to 58:272/290 of 8gsrA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
35% identity, 86% coverage: 27:243/252 of query aligns to 45:266/269 of 4dbhA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
36% identity, 86% coverage: 30:245/252 of query aligns to 54:276/277 of 6iymA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
34% identity, 78% coverage: 46:241/252 of query aligns to 72:273/279 of 6v77B
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
36% identity, 76% coverage: 46:236/252 of query aligns to 14:206/216 of 6sbiA
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
36% identity, 76% coverage: 46:236/252 of query aligns to 15:207/218 of 6fogA
Sites not aligning to the query:
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
36% identity, 76% coverage: 46:236/252 of query aligns to 20:212/224 of Q6P587
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
37% identity, 74% coverage: 33:219/252 of query aligns to 51:229/265 of 3r6oA
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
35% identity, 91% coverage: 10:239/252 of query aligns to 50:256/264 of 6jvwB
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
34% identity, 78% coverage: 46:241/252 of query aligns to 70:274/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
34% identity, 78% coverage: 46:241/252 of query aligns to 70:274/280 of 6j5xA
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
31% identity, 77% coverage: 40:234/252 of query aligns to 12:210/224 of 3v77A
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
31% identity, 78% coverage: 43:239/252 of query aligns to 23:226/233 of 6j5yA
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
25% identity, 75% coverage: 46:233/252 of query aligns to 11:222/247 of 1nkqA
>BPHYT_RS28880 FitnessBrowser__BFirm:BPHYT_RS28880
MMRGRVAYAGAIHEAYPDANGVRLADGRVRREDEVVWLAPIEVGTIFALGLNYAEHAKEL
QFNKQEEPLVFLKGPGTVIGHRGVTRRPADVTFMHYECELAVVIGQTAKNVKRDNAMQHV
AGYMIANDYAIRDYLENYYRPNLRVKNRDGGTVLGPWFVDAADVEDVTQLELRTFVNGTR
QQHGNTRDLVTGIPALIEYLSSFMTLAPGDVILTGTPEGIVNVNAGDEVVCEIDGLGRLV
NTIACDADFNRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory