Comparing BPHYT_RS29185 FitnessBrowser__BFirm:BPHYT_RS29185 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
28% identity, 85% coverage: 38:305/314 of query aligns to 19:277/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
26% identity, 64% coverage: 30:231/314 of query aligns to 31:231/313 of P94529
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
21% identity, 73% coverage: 70:298/314 of query aligns to 244:489/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
21% identity, 73% coverage: 70:298/314 of query aligns to 259:504/514 of P02916
>BPHYT_RS29185 FitnessBrowser__BFirm:BPHYT_RS29185
MHALKLPAGGSSKAHRMRLKKPLKKRFPIAAWLALLPMVMTVVFAYLGTMVWTARVSLSN
SRTFPSGDFAGFTQYARLFNNDRWLLSLQNIVIYGACFIVACMVIGLLLAIFIDQRVVAE
GALRTVFLYPYAMSFVATGLVWQWILNPELGAQAVLHKLGFAHARFDWIVDQDWVIYTIV
IATVWQASGLVMALLLAGLRGIDDELWKAARIDGIPRWRVYVSIVVPMLGPSISTAFVLL
FVMVVKLYDAVVAMTQGGPGTASEVPAKFIMDYLFGRANIGLASAASIVLLATVLAILAP
FFYARSRAALRKEV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory