Comparing BPHYT_RS29190 FitnessBrowser__BFirm:BPHYT_RS29190 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
5dvjA Crystal structure of galactose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
41% identity, 91% coverage: 26:398/412 of query aligns to 2:379/396 of 5dvjA
5dviA High resolution crystal structure of glucose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
41% identity, 91% coverage: 26:398/412 of query aligns to 2:379/396 of 5dviA
8hqqA Crystal structure of the glucose-binding protein sar11_0769 from "candidatus pelagibacter ubique" htcc1062 bound to glucose
40% identity, 91% coverage: 28:401/412 of query aligns to 4:385/398 of 8hqqA
4r2bA Crystal structure of sugar transporter oant_3817 from ochrobactrum anthropi, target efi-510528, with bound glucose
38% identity, 93% coverage: 30:411/412 of query aligns to 8:392/395 of 4r2bA
2b3fA Thermus thermophilus glucose/galactose binding protein bound with galactose (see paper)
29% identity, 79% coverage: 27:353/412 of query aligns to 1:327/392 of 2b3fA
Sites not aligning to the query:
2b3bC Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
29% identity, 79% coverage: 27:353/412 of query aligns to 1:327/392 of 2b3bC
Sites not aligning to the query:
2b3bA Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
29% identity, 79% coverage: 27:353/412 of query aligns to 1:327/392 of 2b3bA
Sites not aligning to the query:
3vxcA Crystal structure of xylobiose-bxle complex from streptomyces thermoviolaceus opc-520
30% identity, 46% coverage: 102:291/412 of query aligns to 79:274/398 of 3vxcA
Sites not aligning to the query:
3oo6A Crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose (see paper)
28% identity, 57% coverage: 74:307/412 of query aligns to 49:281/390 of 3oo6A
Sites not aligning to the query:
4c1tA Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. Lactis bl-04 in complex with arabinoxylotriose (see paper)
29% identity, 56% coverage: 121:352/412 of query aligns to 97:339/396 of 4c1tA
Sites not aligning to the query:
7ehqA Chitin oligosaccharide binding protein (see paper)
26% identity, 43% coverage: 124:301/412 of query aligns to 104:286/406 of 7ehqA
Sites not aligning to the query:
6h0hA The abc transporter associated binding protein from b. Animalis subsp. Lactis bl-04 in complex with beta-1,6-galactobiose (see paper)
29% identity, 33% coverage: 43:179/412 of query aligns to 13:148/410 of 6h0hA
Sites not aligning to the query:
1urgA X-ray structures from the maltose-maltodextrin binding protein of the thermoacidophilic bacterium alicyclobacillus acidocaldarius (see paper)
26% identity, 63% coverage: 116:375/412 of query aligns to 87:330/373 of 1urgA
Sites not aligning to the query:
4r9gA Cpmnbp1 with mannotriose bound (see paper)
23% identity, 66% coverage: 37:308/412 of query aligns to 11:291/394 of 4r9gA
Sites not aligning to the query:
>BPHYT_RS29190 FitnessBrowser__BFirm:BPHYT_RS29190
MNSKKLVLRGVVAALALYGVVAQAEPLKANVIHWWTSGGESAAIRQFADAYNKAGGQWVD
NAVAGADQARSTAINRIVGGDPPTAAQFNTSKQFHDLIDQGLLNNVDDVAAKENWNGVFP
QSIIDSIKVKGHYYAAPVDIHMPAWFFYSKPVFQKAGIAGEPKSYDEFIADLGKLKTAGV
IPLALGGQPWQEKITFDAVLADVGGPDLYMKVYRDRDMNAVKSDAFKKVLASFKRLHDFV
DPGSPGRNWNDATALVISGKAGVQIMGDWAKGEFSAANQSAGKDFGCFPGFGPHSPYLVA
GDVFVFPKTDNPTTIKAQNLLATVMTSPAAQVAFSAKKGSIPIRPDVDGSSLDICAKEGI
AIMKDKSRQLPNPEMLLSPDTQGALIDVVTNFWNKNQSVDDAQKAFASALKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory