SitesBLAST
Comparing BPHYT_RS29195 FitnessBrowser__BFirm:BPHYT_RS29195 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ns8A Crystal structure of beta-glucosidase bglm-g1 mutant h75r from marine metagenome in complex with inhibitor 1-deoxynojirimycin (see paper)
50% identity, 92% coverage: 32:464/470 of query aligns to 5:439/440 of 5ns8A
6z1mA Structure of an ancestral glycosidase (family 1) bound to heme (see paper)
51% identity, 91% coverage: 34:463/470 of query aligns to 5:419/423 of 6z1mA
- binding protoporphyrin ix containing fe: P164 (= P192), N165 (≠ W193), L194 (= L222), L195 (= L223), L218 (≠ A246), L220 (≠ I248), N244 (= N272), F247 (≠ I275), K253 (= K281), Y256 (= Y284), L288 (= L311), R318 (≠ G360), Y323 (= Y365)
- binding magnesium ion: H346 (≠ E390), K409 (≠ R453)
4ptwA Halothermothrix orenii beta-glucosidase a, 2-deoxy-2-fluoro-glucose complex (see paper)
48% identity, 90% coverage: 31:455/470 of query aligns to 2:433/445 of 4ptwA
- active site: R74 (= R103), H118 (= H146), E163 (= E191), V166 (≠ C194), N291 (= N317), Y293 (= Y319), E351 (= E375)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q17 (= Q46), H118 (= H146), E163 (= E191), Y293 (= Y319), E351 (= E375), W398 (= W421), E405 (= E428), W406 (= W429)
4ptvA Halothermothrix orenii beta-glucosidase a, thiocellobiose complex (see paper)
48% identity, 90% coverage: 31:455/470 of query aligns to 2:433/445 of 4ptvA
- active site: R74 (= R103), H118 (= H146), E163 (= E191), V166 (≠ C194), N291 (= N317), Y293 (= Y319), E351 (= E375)
- binding beta-D-glucopyranose: W324 (= W347), E405 (= E428), Y408 (≠ F431)
- binding 4-thio-beta-D-glucopyranose: Q17 (= Q46), H118 (= H146), E163 (= E191), Y293 (= Y319), E351 (= E375), W398 (= W421), E405 (= E428), W406 (= W429)
7wdoA Crystal structures of mebgld2 in complex with various saccharides
49% identity, 91% coverage: 36:463/470 of query aligns to 9:440/445 of 7wdoA
- binding beta-D-glucopyranose: Q19 (= Q46), H120 (= H146), W121 (= W147), N164 (= N190), E165 (= E191), E165 (= E191), N222 (= N247), N224 (≠ G249), Y294 (= Y319), E351 (= E375), W398 (= W421), E405 (= E428), W406 (= W429), F414 (= F437)
7wdsA Crystal structures of mebgld2 in complex with various saccharides
49% identity, 91% coverage: 36:463/470 of query aligns to 9:440/444 of 7wdsA
- binding beta-D-xylopyranose: Q19 (= Q46), H120 (= H146), E165 (= E191), L172 (= L198), Y294 (= Y319), W324 (= W347), E351 (= E375), W398 (= W421), E405 (= E428), W406 (= W429), R408 (≠ F431)
7wdnA Crystal structures of mebgld2 in complex with various saccharides (see paper)
49% identity, 91% coverage: 36:463/470 of query aligns to 9:440/444 of 7wdnA
- binding alpha-D-glucopyranose: Q19 (= Q46), E25 (≠ N52), D35 (= D62), H120 (= H146), E165 (= E191), E165 (= E191), K186 (≠ A212), N222 (= N247), F246 (≠ H271), W266 (= W292), Y267 (≠ P293), Y294 (= Y319), P306 (≠ G331), M307 (≠ F332), W324 (= W347), E351 (= E375), W398 (= W421), E405 (= E428), W406 (= W429), F414 (= F437)
7wdrA Crystal structures of mebgld2 in complex with various saccharides
49% identity, 91% coverage: 36:463/470 of query aligns to 9:440/445 of 7wdrA
- binding 4-nitrophenyl beta-D-glucopyranoside: Q19 (= Q46), H120 (= H146), E165 (= E191), W167 (= W193), N222 (= N247), L223 (≠ I248), N224 (≠ G249), F246 (≠ H271), Y294 (= Y319), A295 (≠ F320), R296 (= R321), T297 (= T322), F312 (≠ L337), W324 (= W347), W324 (= W347), E325 (= E348), W398 (= W421), E405 (= E428), W406 (= W429)
6m6lB The crystal structure of glycosidase hydrolyzing notoginsenoside
48% identity, 92% coverage: 33:466/470 of query aligns to 7:444/445 of 6m6lB
4hz7A Crystal structure of bglb with glucose (see paper)
49% identity, 90% coverage: 34:456/470 of query aligns to 5:429/441 of 4hz7A
- active site: R74 (= R103), H118 (= H146), E163 (= E191), V166 (≠ C194), N290 (= N317), Y292 (= Y319), E347 (= E375)
- binding beta-D-glucopyranose: Q17 (= Q46), H118 (= H146), E163 (= E191), Y292 (= Y319), E347 (= E375), W394 (= W421), E401 (= E428), W402 (= W429), F410 (= F437)
2o9rA Beta-glucosidase b complexed with thiocellobiose (see paper)
45% identity, 91% coverage: 28:455/470 of query aligns to 1:433/445 of 2o9rA
- active site: R76 (= R103), H119 (= H146), E164 (= E191), C167 (= C194), N293 (= N317), Y295 (= Y319), E353 (= E375)
- binding beta-D-glucopyranose: E164 (= E191), Y295 (= Y319), W325 (= W347), E353 (= E375), W399 (= W421), E406 (= E428)
2jieA Beta-glucosidase b from bacillus polymyxa complexed with 2-f-glucose (see paper)
45% identity, 91% coverage: 28:455/470 of query aligns to 1:433/445 of 2jieA
- active site: R76 (= R103), H119 (= H146), E164 (= E191), C167 (= C194), N293 (= N317), Y295 (= Y319), E353 (= E375)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q46), H119 (= H146), N163 (= N190), E164 (= E191), Y295 (= Y319), E353 (= E375), W399 (= W421), E406 (= E428), F415 (= F437)
8ivyA Beta-glucosidase bgla mutant e166q in complex with glucose (see paper)
45% identity, 91% coverage: 34:463/470 of query aligns to 8:444/451 of 8ivyA
6r4kA Structure of beta-glucosidase a from paenibacillus polymyxa complexed with a monovalent inhibitor (see paper)
46% identity, 90% coverage: 34:454/470 of query aligns to 8:431/448 of 6r4kA
- binding (2~{S},3~{S},4~{R})-2-[[4-[4-[2-[2-(2-azanylidenehydrazinyl)ethoxy]ethoxy]phenyl]-1,2,3-triazol-1-yl]methyl]pyrrolidine-3,4-diol: Q20 (= Q46), H121 (= H146), E166 (= E191), L173 (= L198), E352 (= E375), W398 (= W421), E405 (= E428), W406 (= W429)
6qwiA Structure of beta-glucosidase a from paenibacillus polymyxa complexed with multivalent inhibitors. (see paper)
46% identity, 90% coverage: 34:454/470 of query aligns to 8:431/448 of 6qwiA
- binding (2~{S},3~{S},4~{R})-2-[[4-[4-(2-ethoxyethoxy)phenyl]-1,2,3-triazol-1-yl]methyl]pyrrolidine-3,4-diol: Q20 (= Q46), H121 (= H146), W122 (= W147), E166 (= E191), L173 (= L198), W326 (= W347), E352 (= E375), W398 (= W421), E405 (= E428), W406 (= W429)
1gnxA B-glucosidase from streptomyces sp
49% identity, 91% coverage: 34:463/470 of query aligns to 6:442/447 of 1gnxA
- active site: R75 (= R103), H119 (= H146), E164 (= E191), C167 (= C194), N293 (= N317), Y295 (= Y319), E353 (= E375)
- binding beta-D-fructofuranose: Q285 (≠ A309), K286 (≠ P310)
- binding alpha-D-glucopyranose: Q204 (≠ P231), R281 (≠ Q305), Q285 (≠ A309)
- binding sulfate ion: R190 (≠ Q217), F274 (≠ L298), R276 (≠ L300)
1e4iA 2-deoxy-2-fluoro-beta-d-glucosyl/enzyme intermediate complex of the beta-glucosidase from bacillus polymyxa (see paper)
45% identity, 92% coverage: 34:466/470 of query aligns to 7:447/447 of 1e4iA
- active site: R76 (= R103), H120 (= H146), E165 (= E191), C168 (= C194), N293 (= N317), Y295 (= Y319), E351 (= E375)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q46), H120 (= H146), N164 (= N190), E165 (= E191), Y295 (= Y319), E351 (= E375), W397 (= W421), E404 (= E428), W405 (= W429)
- binding 2,4-dinitrophenyl 2-deoxy-2-fluoro-beta-D-glucopyranoside: R136 (= R162), Q140 (≠ Y166), V143 (≠ A169), L202 (= L228)
1bggB Glucosidase a from bacillus polymyxa complexed with gluconate (see paper)
45% identity, 92% coverage: 34:466/470 of query aligns to 7:447/447 of 1bggB
- active site: R76 (= R103), H120 (= H146), E165 (= E191), C168 (= C194), N293 (= N317), Y295 (= Y319), E351 (= E375)
- binding D-gluconic acid: Q19 (= Q46), H120 (= H146), W121 (= W147), N164 (= N190), E165 (= E191), Y295 (= Y319), E351 (= E375), W397 (= W421), E404 (= E428), W405 (= W429)
2cesA Beta-glucosidase from thermotoga maritima in complex with glucoimidazole (see paper)
47% identity, 91% coverage: 34:463/470 of query aligns to 6:435/440 of 2cesA
- active site: R75 (= R103), H119 (= H146), E164 (= E191), V167 (≠ C194), N291 (= N317), Y293 (= Y319), E346 (= E375)
- binding glucoimidazole: Q18 (= Q46), H119 (= H146), N163 (= N190), E164 (= E191), Y293 (= Y319), E346 (= E375), W393 (= W421), E400 (= E428), W401 (= W429), F409 (= F437)
5ossB Beta-glucosidase from thermotoga maritima in complex with gluco-1h- imidazole (see paper)
46% identity, 91% coverage: 34:463/470 of query aligns to 6:438/443 of 5ossB
- active site: R75 (= R103), H119 (= H146), E164 (= E191), V167 (≠ C194), N291 (= N317), Y293 (= Y319), E349 (= E375)
- binding (4~{S},5~{S},6~{R},7~{R})-7-(hydroxymethyl)-4,5,6,7-tetrahydro-1~{H}-benzimidazole-4,5,6-triol: Q18 (= Q46), H119 (= H146), E164 (= E191), Y293 (= Y319), E349 (= E375), W396 (= W421), E403 (= E428), W404 (= W429), F412 (= F437)
Query Sequence
>BPHYT_RS29195 FitnessBrowser__BFirm:BPHYT_RS29195
MANDASAVSDALSPRSPSLADPFTPPADSSLWRKSFLLGAATASYQIEGAVNEDGRLPSI
WDTFSAKPGKVLAGDTGAVACDHYHRWQADVDLLAGLGLEAYRLSIAWPRVMDAAGAPNR
KGLDFYKRLLARLKEKGITTFVTLYHWDLPQHLEDCGGWLNRDTAYRFADYADLMSRELA
GSVDAWMTLNEPWCSAYLGYGNGHHAPGLADARYATQAMHHLLLAHGLAVPVLRANDPAS
QVGIVANIGRGTANSESAADQRAAHLFEVQHNAWILDPLLKGSYPQDLFELWPGTEPLVL
DGDMQTIAAPLDFLGINYYFRTNVASDGAHGFRDVPLEGVERTQMGWEVYPDGLRDLLTG
FKATYANLPPIYITENGMASDDKVIDGQVEDSQRISFLKRHLSAVDQAIKAGVEIRGYFL
WSLMDNFEWAFGYERRFGIVHVDYATQKRTIKRSANLVSKFLKERKARTE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory