SitesBLAST
Comparing BPHYT_RS29280 FitnessBrowser__BFirm:BPHYT_RS29280 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5g4jA Phospholyase a1rdf1 from arthrobacter in complex with phosphoethanolamine (see paper)
41% identity, 95% coverage: 25:442/442 of query aligns to 3:421/423 of 5g4jA
- active site: S14 (≠ Y36), Y130 (= Y154), D201 (= D222), D234 (= D255), Q237 (= Q258), K264 (= K285), T294 (= T315), K395 (= K416)
- binding {5-hydroxy-6-methyl-4-[(E)-{[2-(phosphonooxy)ethyl]imino}methyl]pyridin-3-yl}methyl dihydrogen phosphate: Y44 (= Y66), R73 (= R95), G103 (= G127), S104 (= S128), Y130 (= Y154), H131 (= H155), D234 (= D255), V236 (= V257), Q237 (= Q258), K264 (= K285), T294 (= T315), R397 (= R418)
5g4iA Plp-dependent phospholyase a1rdf1 from arthrobacter aurescens tc1 (see paper)
41% identity, 95% coverage: 25:442/442 of query aligns to 3:421/423 of 5g4iA
- active site: S14 (≠ Y36), Y130 (= Y154), D201 (= D222), D234 (= D255), Q237 (= Q258), K264 (= K285), T294 (= T315), K395 (= K416)
- binding pyridoxal-5'-phosphate: G103 (= G127), S104 (= S128), H131 (= H155), D234 (= D255), V236 (= V257), Q237 (= Q258), K264 (= K285)
- binding phosphate ion: Y44 (= Y66), R397 (= R418)
6torB Human o-phosphoethanolamine phospho-lyase (see paper)
42% identity, 90% coverage: 44:442/442 of query aligns to 1:397/404 of 6torB
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
28% identity, 88% coverage: 42:432/442 of query aligns to 26:437/459 of D6R3B6
- SAGL 155:158 (≠ TSSF 161:164) mutation Missing: Low pungency phenotype, characterized by low levels of capsaicinoids, and accumulation of high levels of capsinoids, which are non-pungent capsaicinoid analogs.
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
31% identity, 95% coverage: 23:442/442 of query aligns to 11:443/448 of 6io1B
- active site: L20 (= L32), Y151 (= Y154), D257 (= D255), K286 (= K285)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (≠ T126), G118 (= G127), A119 (≠ S128), N122 (= N131), Y151 (= Y154), H152 (= H155), D257 (= D255), V259 (= V257), I260 (≠ Q258), K286 (= K285)
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 90% coverage: 42:441/442 of query aligns to 69:490/504 of Q94CE5
- C98 (= C71) mutation to Y: In her1-1; loss of E2-hexenal responses.
- G103 (≠ H74) mutation to N: In her1-2; loss of E2-hexenal responses.
- G271 (≠ D228) mutation to E: In pop2-6; Loss of activity and complete sterility.
- G312 (= G270) mutation to D: In pop2-7; loss of activity.
O50131 Ornithine aminotransferase; Orn-AT; Ornithine delta-aminotransferase; EC 2.6.1.13 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
32% identity, 87% coverage: 46:428/442 of query aligns to 40:431/454 of O50131
- T92 (= T94) mutation to V: Slightly increases the specific activity. Increases KM for L-ornithine.
- D93 (≠ R95) mutation to L: Reduces the specific activity. Increases KM for L-ornithine.
- G124 (= G127) binding
- T125 (≠ S128) binding
- Q267 (= Q258) binding
- K293 (= K285) modified: N6-(pyridoxal phosphate)lysine
- T321 (= T315) binding
7vo1A Structure of aminotransferase-substrate complex (see paper)
32% identity, 87% coverage: 46:428/442 of query aligns to 38:429/452 of 7vo1A
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I61 (vs. gap), S121 (≠ T126), G122 (= G127), T123 (≠ S128), F149 (≠ Y154), H150 (= H155), R152 (≠ N157), E234 (≠ S227), D262 (= D255), V264 (= V257), Q265 (= Q258), K291 (= K285), N318 (= N314), T319 (= T315), R417 (≠ K416)
7vntA Structure of aminotransferase-substrate complex (see paper)
32% identity, 87% coverage: 46:428/442 of query aligns to 38:429/452 of 7vntA
- binding L-ornithine: F149 (≠ Y154), R152 (≠ N157), E234 (≠ S227), K291 (= K285)
- binding pyridoxal-5'-phosphate: G122 (= G127), T123 (≠ S128), F149 (≠ Y154), H150 (= H155), E229 (≠ D222), D262 (= D255), V264 (= V257), Q265 (= Q258), K291 (= K285)
7vnoA Structure of aminotransferase (see paper)
32% identity, 87% coverage: 46:428/442 of query aligns to 38:429/452 of 7vnoA
1zobA Crystal structure of dialkylglycine decarboxylases bound with calcium ion
31% identity, 89% coverage: 42:435/442 of query aligns to 23:423/431 of 1zobA
- active site: W136 (≠ Y154), E208 (≠ D222), D241 (= D255), Q244 (= Q258), K270 (= K285), T301 (= T315), R404 (≠ K416)
- binding calcium ion: L76 (≠ T92), S78 (≠ T94), V303 (≠ G317), S304 (≠ G318), D305 (≠ N319)
- binding pyridoxal-5'-phosphate: T108 (= T126), A110 (≠ S128), N113 (= N131), W136 (≠ Y154), H137 (= H155), E208 (≠ D222), D241 (= D255), A243 (≠ V257), Q244 (= Q258), K270 (= K285)
Sites not aligning to the query:
1zc9A The crystal structure of dialkylglycine decarboxylase complex with pyridoxamine 5-phosphate (see paper)
31% identity, 89% coverage: 42:435/442 of query aligns to 23:423/431 of 1zc9A
- active site: W136 (≠ Y154), E208 (≠ D222), D241 (= D255), Q244 (= Q258), K270 (= K285), T301 (= T315), R404 (≠ K416)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G109 (= G127), A110 (≠ S128), W136 (≠ Y154), H137 (= H155), E208 (≠ D222), D241 (= D255), A243 (≠ V257), Q244 (= Q258), K270 (= K285)
Sites not aligning to the query:
1m0qA Structure of dialkylglycine decarboxylase complexed with s-1- aminoethanephosphonate (see paper)
31% identity, 89% coverage: 42:435/442 of query aligns to 23:423/431 of 1m0qA
- active site: W136 (≠ Y154), E208 (≠ D222), D241 (= D255), Q244 (= Q258), K270 (= K285), T301 (= T315), R404 (≠ K416)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: Q50 (≠ V69), T108 (= T126), A110 (≠ S128), W136 (≠ Y154), H137 (= H155), E208 (≠ D222), S213 (= S227), D241 (= D255), A243 (≠ V257), Q244 (= Q258), K270 (= K285), R404 (≠ K416)
Sites not aligning to the query:
1m0pA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- phenylethanephosphonate (see paper)
31% identity, 89% coverage: 42:435/442 of query aligns to 23:423/431 of 1m0pA
- active site: W136 (≠ Y154), E208 (≠ D222), D241 (= D255), Q244 (= Q258), K270 (= K285), T301 (= T315), R404 (≠ K416)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-phenylethylphosphonic acid: Q50 (≠ V69), T108 (= T126), A110 (≠ S128), W136 (≠ Y154), H137 (= H155), E208 (≠ D222), S213 (= S227), D241 (= D255), A243 (≠ V257), Q244 (= Q258), K270 (= K285), R404 (≠ K416)
Sites not aligning to the query:
1m0oA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- methylpropanephosphonate (see paper)
31% identity, 89% coverage: 42:435/442 of query aligns to 23:423/431 of 1m0oA
- active site: W136 (≠ Y154), E208 (≠ D222), D241 (= D255), Q244 (= Q258), K270 (= K285), T301 (= T315), R404 (≠ K416)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-methylpropylphosphonic acid: Q50 (≠ V69), G109 (= G127), A110 (≠ S128), W136 (≠ Y154), H137 (= H155), E208 (≠ D222), D241 (= D255), Q244 (= Q258), K270 (= K285), R404 (≠ K416)
Sites not aligning to the query:
1m0nA Structure of dialkylglycine decarboxylase complexed with 1- aminocyclopentanephosphonate (see paper)
31% identity, 89% coverage: 42:435/442 of query aligns to 23:423/431 of 1m0nA
- active site: W136 (≠ Y154), E208 (≠ D222), D241 (= D255), Q244 (= Q258), K270 (= K285), T301 (= T315), R404 (≠ K416)
- binding 1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]cyclopentylphosphonic acid: Q50 (≠ V69), M51 (≠ V70), A110 (≠ S128), N113 (= N131), W136 (≠ Y154), H137 (= H155), E208 (≠ D222), S213 (= S227), D241 (= D255), A243 (≠ V257), Q244 (= Q258), K270 (= K285), R404 (≠ K416)
Sites not aligning to the query:
1d7vA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with nma (see paper)
31% identity, 89% coverage: 42:435/442 of query aligns to 23:423/431 of 1d7vA
- active site: W136 (≠ Y154), E208 (≠ D222), D241 (= D255), Q244 (= Q258), K270 (= K285), T301 (= T315), R404 (≠ K416)
- binding potassium ion: H75 (≠ C91), L76 (≠ T92), F77 (≠ H93), S78 (≠ T94), T301 (= T315), H302 (≠ F316), V303 (≠ G317), S304 (≠ G318), D305 (≠ N319)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-2-methylalanine: A110 (≠ S128), W136 (≠ Y154), H137 (= H155), E208 (≠ D222), S213 (= S227), D241 (= D255), A243 (≠ V257), Q244 (= Q258), K270 (= K285), R404 (≠ K416)
Sites not aligning to the query:
1d7uA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with lcs (see paper)
31% identity, 89% coverage: 42:435/442 of query aligns to 23:423/431 of 1d7uA
- active site: W136 (≠ Y154), E208 (≠ D222), D241 (= D255), Q244 (= Q258), K270 (= K285), T301 (= T315), R404 (≠ K416)
- binding potassium ion: H75 (≠ C91), L76 (≠ T92), F77 (≠ H93), S78 (≠ T94), T301 (= T315), H302 (≠ F316), V303 (≠ G317), S304 (≠ G318), D305 (≠ N319)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G109 (= G127), A110 (≠ S128), W136 (≠ Y154), H137 (= H155), E208 (≠ D222), D241 (= D255), A243 (≠ V257), Q244 (= Q258), K270 (= K285), R404 (≠ K416)
Sites not aligning to the query:
1d7sA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with dcs (see paper)
31% identity, 89% coverage: 42:435/442 of query aligns to 23:423/431 of 1d7sA
- active site: W136 (≠ Y154), E208 (≠ D222), D241 (= D255), Q244 (= Q258), K270 (= K285), T301 (= T315), R404 (≠ K416)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Q50 (≠ V69), G109 (= G127), A110 (≠ S128), W136 (≠ Y154), H137 (= H155), E208 (≠ D222), D241 (= D255), A243 (≠ V257), Q244 (= Q258), K270 (= K285), R404 (≠ K416)
- binding potassium ion: H75 (≠ C91), L76 (≠ T92), F77 (≠ H93), S78 (≠ T94), T301 (= T315), H302 (≠ F316), V303 (≠ G317), S304 (≠ G318), D305 (≠ N319)
Sites not aligning to the query:
1d7rA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with 5pa (see paper)
31% identity, 89% coverage: 42:435/442 of query aligns to 23:423/431 of 1d7rA
- active site: W136 (≠ Y154), E208 (≠ D222), D241 (= D255), Q244 (= Q258), K270 (= K285), T301 (= T315), R404 (≠ K416)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: G109 (= G127), A110 (≠ S128), W136 (≠ Y154), H137 (= H155), E208 (≠ D222), S213 (= S227), D241 (= D255), A243 (≠ V257), Q244 (= Q258), K270 (= K285), R404 (≠ K416)
- binding potassium ion: H75 (≠ C91), L76 (≠ T92), F77 (≠ H93), S78 (≠ T94), T301 (= T315), H302 (≠ F316), V303 (≠ G317), S304 (≠ G318), D305 (≠ N319)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS29280 FitnessBrowser__BFirm:BPHYT_RS29280
MRGDMPNGFDPASLDHLDAGTQRHIARRLRLLSPSYRLFYAEPVKIVRGEKVYLYDDQGN
DYLDAYNNVVCVGHANPRIVDAVTRQLSTLCTHTRYMQEPILDYAEDLLSTFNTSIRAGQ
MMFTCTGSEANDLATRIAMQYAGKTGVIVTSEAYHGNSHLTSSFSPSLGRRALLGPYVRT
VPAPDSYRMTPSEIGQRMAAQVALQIEDIRRHGGGLAAFIADSFFSSDGVFAHPTDVLAP
VAEVVRRAGGLFIADEVQSGFGRSGTHMWGHERHGVVPDIVTLGKPMGNGYPVAGLVVRP
EVVAGFGQDMRYFNTFGGNSVAIAAAQATLDVLRDEHVLDNAQRVGAILAEGLNALARKY
ECIGDVRGTGLYFGVEIVRDRAKKDTDIATALKIVNGLRQRRVLISATGPDASVLKIRPP
LVFGANDADRLLTELDTVLAAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory