SitesBLAST
Comparing BPHYT_RS29415 FitnessBrowser__BFirm:BPHYT_RS29415 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
32% identity, 96% coverage: 3:285/296 of query aligns to 4:287/294 of 5je8B
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
32% identity, 96% coverage: 5:287/296 of query aligns to 41:329/335 of P29266
- D68 (= D32) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K173) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q177) mutation to Q: Decrease in activity.
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
31% identity, 96% coverage: 5:287/296 of query aligns to 3:291/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), N10 (≠ A12), M11 (= M13), Y29 (≠ C31), D30 (= D32), V31 (≠ L33), M63 (≠ L65), L64 (≠ V66), P65 (≠ V67), T95 (= T97), V120 (= V122), G122 (= G124), F238 (≠ S234), K245 (= K241)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
31% identity, 96% coverage: 5:287/296 of query aligns to 42:330/336 of P31937
- LP 103:104 (≠ VV 66:67) binding
- N108 (≠ Q71) binding
- T134 (= T97) binding
- K284 (= K241) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
34% identity, 89% coverage: 4:267/296 of query aligns to 15:277/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G9), L21 (= L10), G22 (= G11), I23 (≠ A12), M24 (= M13), N43 (≠ D32), R44 (≠ L33), T45 (≠ R34), K48 (≠ V37), V77 (= V66), S78 (≠ V67), D82 (≠ Q71), Q85 (≠ A74), V133 (= V122), F244 (≠ S234), K245 (≠ A235), H248 (≠ I238), K251 (= K241)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
33% identity, 89% coverage: 4:267/296 of query aligns to 15:274/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G9), L21 (= L10), G22 (= G11), I23 (≠ A12), M24 (= M13), N43 (≠ D32), R44 (≠ L33), T45 (≠ R34), K48 (≠ V37), M76 (≠ L65), V77 (= V66), S78 (≠ V67), D82 (≠ Q71), Q85 (≠ A74), V133 (= V122), F241 (≠ S234), K242 (≠ A235), H245 (≠ I238), K248 (= K241)
- binding sulfate ion: T134 (≠ S123), G135 (= G124), K183 (= K173)
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
30% identity, 95% coverage: 5:285/296 of query aligns to 3:283/294 of 6smyA
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
30% identity, 95% coverage: 5:285/296 of query aligns to 3:283/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), Q10 (≠ A12), M11 (= M13), F29 (≠ C31), D30 (= D32), V31 (≠ L33), M63 (≠ L65), L64 (≠ V66), V73 (= V75), S94 (≠ A96), T95 (= T97), R122 (≠ G124)
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
30% identity, 95% coverage: 5:285/296 of query aligns to 4:284/298 of P0A9V8
- QM 11:12 (≠ AM 12:13) binding
- D31 (= D32) binding
- L65 (≠ V66) binding
- T96 (= T97) binding
- G122 (≠ S123) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G124) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G125) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NQLLA 176:180) binding
- K240 (= K241) binding
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
31% identity, 97% coverage: 2:287/296 of query aligns to 1:285/287 of 3pefA
- binding glycerol: D67 (≠ N68), G123 (= G124), K171 (= K173), N175 (≠ Q177), M178 (≠ A180), L203 (≠ Y205), G207 (≠ T209), N213 (≠ S215), A217 (≠ E219), F232 (≠ S234), H236 (≠ I238), K239 (= K241), R242 (≠ G244), R269 (≠ S271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G11), I11 (≠ A12), M12 (= M13), N31 (≠ D32), R32 (≠ L33), S33 (≠ R34), K36 (≠ V37), M64 (≠ L65), L65 (≠ V66), A66 (≠ V67), A70 (≠ Q71), E73 (≠ A74), T96 (= T97), V121 (= V122), G123 (= G124), S124 (≠ G125), A231 (≠ L233), F232 (≠ S234), H236 (≠ I238), K239 (= K241)
2uyyA Structure of the cytokine-like nuclear factor n-pac
26% identity, 97% coverage: 2:287/296 of query aligns to 6:290/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G11), L16 (≠ A12), M17 (= M13), N36 (≠ D32), R37 (≠ L33), T38 (≠ R34), V70 (= V66), S71 (≠ V67), A75 (≠ Q71), T101 (= T97), F237 (≠ S234), Y238 (≠ A235), Y241 (≠ I238), K244 (= K241)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
26% identity, 96% coverage: 3:287/296 of query aligns to 268:551/553 of Q49A26
- 271:285 (vs. 6:20, 47% identical) binding
- T362 (= T97) binding
- M437 (≠ K173) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (= P232) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K241) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
30% identity, 95% coverage: 6:287/296 of query aligns to 5:285/287 of 3pduA
- binding glycerol: R242 (≠ G244), E246 (≠ D248), E246 (≠ D248), R250 (= R252)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), G10 (= G11), I11 (≠ A12), M12 (= M13), N31 (≠ D32), R32 (≠ L33), N33 (≠ R34), M64 (≠ L65), L65 (≠ V66), A66 (≠ V67), A70 (≠ Q71), T96 (= T97), V121 (= V122), G123 (= G124), T124 (≠ G125), K171 (= K173), S231 (≠ L233), F232 (≠ S234), P233 (≠ A235), H236 (≠ I238), K239 (= K241)
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
26% identity, 96% coverage: 3:287/296 of query aligns to 267:544/546 of Q922P9
- P489 (= P232) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
31% identity, 96% coverage: 3:287/296 of query aligns to 2:292/298 of Q9I5I6
- 2:31 (vs. 3:32, 40% identical) binding
- P66 (≠ V67) binding
- T96 (= T97) binding ; mutation to A: Almost abolished activity.
- S122 (= S123) mutation to A: Strongly reduced activity.
- K171 (= K173) active site
- N175 (≠ Q177) mutation to A: Strongly reduced activity.
- W214 (= W216) mutation to A: Almost abolished activity.
- Y219 (vs. gap) mutation to A: Strongly reduced activity.
- K246 (= K241) binding ; mutation to A: Almost abolished activity.
- D247 (= D242) mutation to A: Almost abolished activity.
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
32% identity, 96% coverage: 3:287/296 of query aligns to 1:290/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), H10 (≠ A12), M11 (= M13), F29 (≠ C31), D30 (= D32), L31 (= L33), M63 (≠ L65), L64 (≠ V66), P65 (≠ V67), T94 (= T97), V119 (= V122), G121 (= G124), F237 (≠ S234), K244 (= K241)
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
31% identity, 96% coverage: 3:287/296 of query aligns to 2:291/295 of 3obbA
Q8T079 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60 homolog; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1 homolog from Drosophila melanogaster (Fruit fly) (see paper)
24% identity, 95% coverage: 3:284/296 of query aligns to 316:597/602 of Q8T079
Sites not aligning to the query:
- 8 modified: Phosphoserine
- 10 modified: Phosphoserine
- 224 modified: Phosphoserine
- 228 modified: Phosphoserine
- 243 modified: Phosphoserine
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
30% identity, 91% coverage: 4:271/296 of query aligns to 3:264/289 of 2cvzC
- active site: S117 (= S123), K165 (= K173), N168 (= N176), N169 (≠ Q177)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), L9 (= L10), G10 (= G11), A11 (= A12), M12 (= M13), N30 (≠ R34), R31 (≠ S35), T32 (≠ E36), C62 (≠ L65), L63 (≠ V66), P64 (≠ V67), E68 (≠ Q71), E71 (≠ A74), S91 (≠ T97), V116 (= V122), F227 (≠ S234), K234 (= K241)
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
30% identity, 91% coverage: 4:271/296 of query aligns to 2:263/288 of 1wp4A
- active site: S116 (= S123), K164 (= K173), N167 (= N176), N168 (≠ Q177)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G9), L8 (= L10), G9 (= G11), A10 (= A12), M11 (= M13), N29 (≠ R34), R30 (≠ S35), T31 (≠ E36), K34 (≠ N39), C61 (≠ L65), L62 (≠ V66), P63 (≠ V67), E67 (≠ Q71), S90 (≠ T97), V115 (= V122), T225 (≠ L233), F226 (≠ S234), K233 (= K241)
- binding sulfate ion: S116 (= S123), G117 (= G124), G118 (= G125), K164 (= K173)
Query Sequence
>BPHYT_RS29415 FitnessBrowser__BFirm:BPHYT_RS29415
MSRNVGVIGLGAMGLGVARSLLRAGLKVHACDLRSEVLNAFVAEGGVGCATPAELGAQCE
VVVTLVVNAAQTEAVLFGEQGAVAAMKPGRVVIASATVAPDFAIQLGKRIEAAGLQMLDA
PVSGGAARAASGEMTMMTSGPAAAYAACEDVLAAMAGKVYRLGSEHGAGSKVKIINQLLA
GVHIAVAAEAMALGLREGVDPDALYEVITHSAGNSWMFENRVPHILNGDYTPLSAVDIFV
KDLGLVLDTARRSKFPLPLSAAAHQMFMMASTAGHGGEDDSAVIKIFPGIDVPAAK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory