SitesBLAST
Comparing BPHYT_RS29430 FitnessBrowser__BFirm:BPHYT_RS29430 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
28% identity, 48% coverage: 24:231/433 of query aligns to 42:235/444 of Q8NLB7
- D54 (≠ E32) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D35) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R87) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
8fvzA Pipt y150a
24% identity, 82% coverage: 27:383/433 of query aligns to 11:375/433 of 8fvzA
8sc3A Human oct1 bound to fenoterol in inward-open conformation (see paper)
33% identity, 35% coverage: 45:195/433 of query aligns to 116:245/445 of 8sc3A
Sites not aligning to the query:
8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
33% identity, 35% coverage: 45:195/433 of query aligns to 116:245/453 of 8sc2A
Sites not aligning to the query:
8sc6A Human oct1 bound to thiamine in inward-open conformation (see paper)
33% identity, 35% coverage: 45:195/433 of query aligns to 116:245/447 of 8sc6A
Sites not aligning to the query:
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
33% identity, 35% coverage: 45:195/433 of query aligns to 134:263/554 of O15245
- L160 (≠ I72) to F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- S189 (= S104) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ A143) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ W162) mutation to F: Decreased TEA uptake.
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 283 P → L: in dbSNP:rs4646277; P→A: Decreased TEA uptake.
- 287 R → G: in dbSNP:rs4646278
- 341 P → L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- 342 R → H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- 361 Y→F: Decreased TEA uptake.
- 376 Y→F: Decreased TEA uptake.
- 401 G → S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- 408 M → V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- 420 natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- 440 M → I: in dbSNP:rs35956182
- 461 V → I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- 465 G → R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; G→A: No changes in MPP(+) uptake.
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
8et8A Cryo-em structure of the organic cation transporter 1 in complex with verapamil (see paper)
36% identity, 24% coverage: 76:181/433 of query aligns to 160:257/532 of 8et8A
Sites not aligning to the query:
- binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: 31, 35, 353, 360, 378, 381, 385, 449, 469
8et7A Cryo-em structure of the organic cation transporter 1 in complex with diphenhydramine (see paper)
36% identity, 24% coverage: 76:181/433 of query aligns to 160:257/532 of 8et7A
Sites not aligning to the query:
8et9A Cryo-em structure of the organic cation transporter 2 in complex with 1-methyl-4-phenylpyridinium (see paper)
25% identity, 82% coverage: 76:432/433 of query aligns to 160:505/517 of 8et9A
Query Sequence
>BPHYT_RS29430 FitnessBrowser__BFirm:BPHYT_RS29430
MSTTTHPSHAVDANQPASRGAIAAAVIGNWLEFFDFTVYGFFAVIIGKLYFPSADPTTSL
LLSVATFAAGFITRPLGSVMLGVYADRKGRKAALNLTIMLMAVSTGLIAIAPTYAQIGLA
APLLIVFARLVQGFSQGGEFGAATSTLLEQGGGTRRGFRASWQLATQGGAALMGSGIAAA
LSGALPKDSLESWGWRIPFLLGVLIAPVGMYLRRRLADDAASAHSHAIERGVLHELFTQH
VRTLVLITLTVMGGTVSTYILTFYMPTYAIHTLGLPMSLSMLVGVAAGFVMLITCPLFGM
LSDRIGSRKRPILFGRGVLVLLLFPAFMLINRFPQLPVIMSLTALMLLFYSMGSASEFAL
MCESFPRRVRATGISIAYALSVCVFGGTAQLVATWLIKLTGSKLAPAGYVAACVVVSLIA
VSMLKETADKPID
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory