Comparing BPHYT_RS29570 BPHYT_RS29570 ABC transporter to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
59% identity, 93% coverage: 20:291/291 of query aligns to 7:278/278 of 2ia4B
2vhaA Debp (see paper)
59% identity, 93% coverage: 20:290/291 of query aligns to 6:276/276 of 2vhaA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
61% identity, 84% coverage: 20:263/291 of query aligns to 4:247/503 of 8ovoA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
29% identity, 83% coverage: 19:259/291 of query aligns to 3:234/243 of 5eyfB
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
28% identity, 81% coverage: 24:259/291 of query aligns to 5:227/229 of 6svfA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
31% identity, 82% coverage: 20:259/291 of query aligns to 1:228/229 of 5t0wA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
29% identity, 79% coverage: 29:259/291 of query aligns to 4:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
29% identity, 79% coverage: 29:259/291 of query aligns to 4:223/225 of 4zv2A
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
28% identity, 87% coverage: 13:264/291 of query aligns to 35:278/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
28% identity, 87% coverage: 13:264/291 of query aligns to 35:278/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
28% identity, 87% coverage: 13:264/291 of query aligns to 36:279/288 of 6h2tA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
28% identity, 83% coverage: 20:260/291 of query aligns to 2:232/247 of 2yjpA
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
23% identity, 82% coverage: 22:260/291 of query aligns to 3:231/231 of 2v25A
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
23% identity, 80% coverage: 27:259/291 of query aligns to 4:227/228 of 2y7iA
4ohnA Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
23% identity, 84% coverage: 22:266/291 of query aligns to 6:246/246 of 4ohnA
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
26% identity, 79% coverage: 29:259/291 of query aligns to 1:228/235 of 5owfA
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
25% identity, 75% coverage: 21:238/291 of query aligns to 7:224/324 of 4z9nB
5lomB Crystal structure of the pbp soca from agrobacterium tumefaciens c58 in complex with dfg at 1.5 a resolution (see paper)
25% identity, 81% coverage: 30:264/291 of query aligns to 13:237/250 of 5lomB
5l9oB Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
25% identity, 81% coverage: 30:264/291 of query aligns to 12:236/243 of 5l9oB
5l9oA Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
25% identity, 81% coverage: 30:264/291 of query aligns to 11:235/241 of 5l9oA
>BPHYT_RS29570 BPHYT_RS29570 ABC transporter
MALATFAVVSTSASAQETQSTLAKIRSGNSISIGHRETSVPFSYVDTNNQVIGFSQDICN
RIIDAVKAKTGHPDLHVRFIPVTSQNRIPLVQNGTVDLECGVTTNLTSRQNQVAFSDTFF
VATTRLLTRKDSGIKDFTDLAGKTVVTNQGTTSERLLRKMNEEKKMNMQIISAKDYGEGR
VTLETGRAVAYMMDDVLLAGARSLTAKPADWVIVGAPQSSEAYGFMLRKDDPEFKRLVDD
AMVRVMKGSEIKTLYDKWFLKPVPPKGINFDFPMSEALEKLYATPNDRAFD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory