SitesBLAST
Comparing BPHYT_RS29705 FitnessBrowser__BFirm:BPHYT_RS29705 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
56% identity, 84% coverage: 22:224/241 of query aligns to 24:221/229 of P77165
- C99 (= C101) binding
- C104 (= C106) binding
- G105 (= G107) binding
- C107 (= C109) binding
- C119 (= C121) binding
- C158 (= C160) binding
- C161 (= C163) binding
- C208 (= C211) binding
- C210 (= C213) binding
5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
63% identity, 67% coverage: 64:224/241 of query aligns to 11:170/175 of 5g5gA
- binding fe2/s2 (inorganic) cluster: G47 (= G100), C48 (= C101), D49 (= D102), G51 (= G104), C53 (= C106), G54 (= G107), C56 (= C109), C68 (= C121), C107 (= C160), G108 (= G161), C110 (= C163), C157 (= C211), C159 (= C213)
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
55% identity, 66% coverage: 65:224/241 of query aligns to 5:149/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (= G100), C41 (= C101), D42 (= D102), G44 (= G104), C46 (= C106), G47 (= G107), C49 (= C109), C61 (= C121), C101 (= C160), G102 (= G161), C104 (= C163), C136 (= C211), C138 (= C213)
- binding pterin cytosine dinucleotide: Q100 (= Q159), C138 (= C213)
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
48% identity, 68% coverage: 65:228/241 of query aligns to 12:158/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (= C101), S50 (≠ G104), C52 (= C106), G53 (= G107), C55 (= C109), C67 (= C121), C106 (= C160), G107 (= G161), C109 (= C163), C141 (= C211), C143 (= C213)
- binding pterin cytosine dinucleotide: Q105 (= Q159), C143 (= C213)
1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
46% identity, 66% coverage: 65:223/241 of query aligns to 6:148/162 of 1t3qA
- binding fe2/s2 (inorganic) cluster: I40 (≠ K99), C42 (= C101), E43 (≠ D102), G45 (= G104), C47 (= C106), G48 (= G107), C50 (= C109), R60 (≠ N119), C62 (= C121), C101 (= C160), G102 (= G161), C104 (= C163), C136 (= C211), C138 (= C213)
- binding pterin cytosine dinucleotide: Q100 (= Q159), C138 (= C213)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
43% identity, 68% coverage: 62:224/241 of query aligns to 2:148/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C101), S44 (≠ G104), H45 (≠ Q105), C46 (= C106), G47 (= G107), C49 (= C109), C61 (= C121), C100 (= C160), G101 (= G161), C103 (= C163), C135 (= C211), C137 (= C213)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
43% identity, 68% coverage: 62:224/241 of query aligns to 1:147/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ K99), C40 (= C101), S43 (≠ G104), C45 (= C106), G46 (= G107), C48 (= C109), C60 (= C121), C99 (= C160), G100 (= G161), C102 (= C163), C134 (= C211), C136 (= C213)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q159), C136 (= C213)
3hrdD Crystal structure of nicotinate dehydrogenase (see paper)
43% identity, 68% coverage: 65:228/241 of query aligns to 6:153/160 of 3hrdD
- binding flavin-adenine dinucleotide: E44 (≠ R103), G45 (= G104), E46 (≠ Q105)
- binding fe2/s2 (inorganic) cluster: E40 (≠ K99), C42 (= C101), S43 (≠ D102), G45 (= G104), C47 (= C106), G48 (= G107), C50 (= C109), C62 (= C121), Q100 (= Q159), C101 (= C160), G102 (= G161), C104 (= C163), C136 (= C211), C138 (= C213)
- binding pterin cytosine dinucleotide: Q100 (= Q159), C138 (= C213)
Q0QLF3 Nicotinate dehydrogenase small FeS subunit; NDH; Nicotinic acid hydroxylase small FeS subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
43% identity, 68% coverage: 65:228/241 of query aligns to 6:153/157 of Q0QLF3
- C42 (= C101) binding
- C47 (= C106) binding
- C50 (= C109) binding
- C62 (= C121) binding
- C101 (= C160) binding
- C104 (= C163) binding
- C136 (= C211) binding
- C138 (= C213) binding
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
45% identity, 65% coverage: 67:223/241 of query aligns to 7:147/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ K99), C41 (= C101), G44 (= G104), C46 (= C106), G47 (= G107), C49 (= C109), C61 (= C121), C100 (= C160), G101 (= G161), C103 (= C163), C135 (= C211), C137 (= C213)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q159), C137 (= C213)
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
41% identity, 66% coverage: 66:223/241 of query aligns to 5:149/906 of 1dgjA
- binding fe2/s2 (inorganic) cluster: V38 (≠ K99), G39 (= G100), C40 (= C101), G41 (≠ D102), G43 (= G104), Q44 (= Q105), C45 (= C106), G46 (= G107), C48 (= C109), R58 (≠ N119), C60 (= C121), C100 (= C160), G101 (= G161), C103 (= C163), C137 (= C211), C139 (= C213)
- binding pterin cytosine dinucleotide: Q99 (= Q159), C139 (= C213)
Sites not aligning to the query:
- active site: 391, 427, 503, 507, 535, 869, 870
- binding molybdenum (iv)oxide: 424, 535, 698, 869
- binding pterin cytosine dinucleotide: 423, 424, 535, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
40% identity, 66% coverage: 65:224/241 of query aligns to 6:150/166 of P19921
- C42 (= C101) binding
- C47 (= C106) binding
- C50 (= C109) binding
- C62 (= C121) binding
- C102 (= C160) binding
- C105 (= C163) binding
- C137 (= C211) binding
- C139 (= C213) binding
1n5wD Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
40% identity, 66% coverage: 65:224/241 of query aligns to 4:148/158 of 1n5wD
- binding flavin-adenine dinucleotide: S43 (≠ G104), H44 (≠ Q105)
- binding fe2/s2 (inorganic) cluster: C40 (= C101), S43 (≠ G104), C45 (= C106), G46 (= G107), C48 (= C109), C60 (= C121), C100 (= C160), G101 (= G161), C103 (= C163), C135 (= C211), C137 (= C213)
- binding pterin cytosine dinucleotide: Q99 (= Q159), C137 (= C213)
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
40% identity, 66% coverage: 65:224/241 of query aligns to 4:148/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (≠ G104), H44 (≠ Q105)
- binding fe2/s2 (inorganic) cluster: I38 (≠ K99), G39 (= G100), C40 (= C101), S43 (≠ G104), C45 (= C106), G46 (= G107), C48 (= C109), C60 (= C121), C100 (= C160), G101 (= G161), C103 (= C163), C135 (= C211), C137 (= C213)
7dqxC Crystal structure of xanthine dehydrogenase family protein
41% identity, 68% coverage: 65:227/241 of query aligns to 6:154/160 of 7dqxC
- binding fe2/s2 (inorganic) cluster: C42 (= C101), G45 (= G104), V46 (≠ Q105), C47 (= C106), C50 (= C109), R60 (≠ N119), C62 (= C121), Q100 (= Q159), C101 (= C160), C104 (= C163), C137 (= C211), C139 (= C213)
- binding pterin cytosine dinucleotide: Q100 (= Q159), C139 (= C213)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
37% identity, 66% coverage: 66:223/241 of query aligns to 5:149/907 of 4usaA
- binding fe2/s2 (inorganic) cluster: V38 (≠ K99), C40 (= C101), E41 (≠ D102), G43 (= G104), C45 (= C106), G46 (= G107), C48 (= C109), R58 (≠ N119), C60 (= C121), C100 (= C160), G101 (= G161), C103 (= C163), C137 (= C211), C139 (= C213)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q159), C139 (= C213)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 531, 532, 535, 539
- binding hydrocinnamic acid: 255, 425, 494, 497, 535, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
37% identity, 66% coverage: 66:223/241 of query aligns to 5:149/907 of 4us9A
- binding fe2/s2 (inorganic) cluster: V38 (≠ K99), C40 (= C101), E41 (≠ D102), G43 (= G104), C45 (= C106), G46 (= G107), C48 (= C109), R58 (≠ N119), C60 (= C121), C100 (= C160), G101 (= G161), C103 (= C163), C137 (= C211), C139 (= C213)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q159), C139 (= C213)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 3-phenylpropanal: 255, 257, 258, 752
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
37% identity, 66% coverage: 66:223/241 of query aligns to 5:149/907 of 4us8A
- binding fe2/s2 (inorganic) cluster: V38 (≠ K99), C40 (= C101), E41 (≠ D102), G43 (= G104), C45 (= C106), G46 (= G107), C48 (= C109), R58 (≠ N119), C60 (= C121), C100 (= C160), G101 (= G161), C103 (= C163), C137 (= C211), C139 (= C213)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q159), C139 (= C213)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding benzaldehyde: 255, 255, 394, 425, 425, 425, 425, 497, 497, 501, 531, 535, 535, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
37% identity, 66% coverage: 66:223/241 of query aligns to 5:149/907 of 4c7yA
- binding fe2/s2 (inorganic) cluster: C40 (= C101), E41 (≠ D102), G43 (= G104), C45 (= C106), G46 (= G107), C48 (= C109), R58 (≠ N119), C60 (= C121), C100 (= C160), G101 (= G161), C103 (= C163), C137 (= C211), C139 (= C213)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q159), C139 (= C213)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 535, 539
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
37% identity, 66% coverage: 66:223/241 of query aligns to 5:149/907 of 3fc4A
- binding fe2/s2 (inorganic) cluster: V38 (≠ K99), C40 (= C101), E41 (≠ D102), G43 (= G104), C45 (= C106), G46 (= G107), C48 (= C109), R58 (≠ N119), C60 (= C121), C100 (= C160), G101 (= G161), C103 (= C163), C137 (= C211), C139 (= C213)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q159), C139 (= C213)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 1,2-ethanediol: 535, 622, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Query Sequence
>BPHYT_RS29705 FitnessBrowser__BFirm:BPHYT_RS29705
MSSHNESQDPGDVPAAIPTKPSRRRFLQSAAAAATVGAAPHLRAQTQTPTAPPAQVQQAV
PPRPVTLTVNGRAYTLQLEPRVTLLDALREYAGLMGTKKGCDRGQCGACTVLADGRRINS
CLTLAVMHEGENITTVEGLAANGVLSPIQRAFIEHDAFQCGYCTPGQLCSATALLNEFRN
GTASTVTADVRIRPAQLSDEEIRERMSGNICRCGAYANIVAAVRAVHEGGGPVSGNDNPN
A
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory