Comparing BPHYT_RS29810 FitnessBrowser__BFirm:BPHYT_RS29810 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
47% identity, 93% coverage: 5:133/139 of query aligns to 106:233/233 of 4n6bA
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
46% identity, 93% coverage: 5:133/139 of query aligns to 113:243/243 of 4n69A
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
44% identity, 91% coverage: 5:131/139 of query aligns to 115:243/261 of 6wyeA
Sites not aligning to the query:
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
44% identity, 91% coverage: 5:131/139 of query aligns to 113:241/243 of 7ra4A
Sites not aligning to the query:
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
41% identity, 95% coverage: 2:133/139 of query aligns to 111:244/262 of 1t3dA
Sites not aligning to the query:
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
38% identity, 97% coverage: 5:139/139 of query aligns to 110:246/257 of 1ssqD
Sites not aligning to the query:
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
40% identity, 95% coverage: 2:133/139 of query aligns to 107:240/258 of 8i04A
Sites not aligning to the query:
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
40% identity, 95% coverage: 2:133/139 of query aligns to 110:243/246 of 8i09A
Sites not aligning to the query:
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
40% identity, 95% coverage: 2:133/139 of query aligns to 111:244/244 of 8i06A
Sites not aligning to the query:
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
39% identity, 95% coverage: 2:133/139 of query aligns to 114:247/272 of 3gvdI
Sites not aligning to the query:
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
38% identity, 95% coverage: 2:133/139 of query aligns to 107:240/258 of 4h7oA
Sites not aligning to the query:
1sstA Serine acetyltransferase- complex with coa (see paper)
40% identity, 93% coverage: 5:133/139 of query aligns to 110:233/233 of 1sstA
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
36% identity, 95% coverage: 2:133/139 of query aligns to 111:244/250 of 4hzdA
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
34% identity, 99% coverage: 2:138/139 of query aligns to 133:273/280 of 7bw9A
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
35% identity, 73% coverage: 34:134/139 of query aligns to 70:182/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
35% identity, 73% coverage: 34:134/139 of query aligns to 70:182/201 of 1kruA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 73% coverage: 34:134/139 of query aligns to 71:183/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
35% identity, 73% coverage: 34:134/139 of query aligns to 70:182/200 of 1krrA
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
37% identity, 71% coverage: 38:135/139 of query aligns to 74:183/186 of 4isxA
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
29% identity, 88% coverage: 4:125/139 of query aligns to 135:266/267 of 3q1xA
>BPHYT_RS29810 FitnessBrowser__BFirm:BPHYT_RS29810
MLHIYRIAHLLHRLRVPFLPWALKVFNRIVFSVSLPPSVTVGRNVVFGYQGLGIVVHRQA
VLGNDIVISPNVVIGGRGQPGAPVIGDNVLIGAGACILGPVTIGQNVKIGANAVVTFDVP
PDVTVVGVPARIVQPRRSV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory