SitesBLAST
Comparing BPHYT_RS30065 FitnessBrowser__BFirm:BPHYT_RS30065 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4k28A 2.15 angstrom resolution crystal structure of a shikimate dehydrogenase family protein from pseudomonas putida kt2440 in complex with NAD+ (see paper)
36% identity, 87% coverage: 19:263/282 of query aligns to 2:248/266 of 4k28A
- binding manganese (ii) ion: C153 (≠ R170), C164 (≠ I181), V176 (≠ R193), F180 (≠ A197)
- binding nicotinamide-adenine-dinucleotide: I129 (≠ V146), G130 (= G147), G132 (= G149), G133 (= G150), V134 (≠ A151), C153 (≠ R170), D154 (= D171), P155 (≠ N172), R159 (= R176), S193 (= S211), P194 (= P212), V222 (= V237), G245 (= G260), M248 (= M263)
Sites not aligning to the query:
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
30% identity, 85% coverage: 26:264/282 of query aligns to 5:236/269 of Q5HNV1
- SLS 13:15 (≠ VRS 34:36) binding
- T60 (= T82) binding
- N85 (= N107) binding
- D100 (= D123) binding
- Y211 (≠ T239) Plays a major role in the catalytic process and a minor role in the substrate binding; mutation to F: Leads to a 345-fold decrease in the catalytic efficiency and a 3-fold decrease in the affinity binding for shikimate.
Sites not aligning to the query:
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
29% identity, 85% coverage: 26:264/282 of query aligns to 5:227/258 of 3dooA
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S13 (≠ V34), S15 (= S36), N58 (≠ I80), T60 (= T82), K64 (= K86), N85 (= N107), D100 (= D123), F227 (= F264)
Sites not aligning to the query:
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
30% identity, 91% coverage: 9:264/282 of query aligns to 1:265/291 of 3tozA
- binding nicotinamide-adenine-dinucleotide: G137 (= G147), A138 (= A148), G139 (= G149), G140 (= G150), A141 (= A151), N161 (vs. gap), R162 (= R170), D164 (≠ N172), F166 (vs. gap), T210 (≠ S211), G211 (≠ P212), V212 (≠ L213), M214 (= M215), F217 (vs. gap), V238 (= V237), Y240 (≠ T239), G261 (= G260), M264 (= M263), M265 (≠ F264)
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
30% identity, 91% coverage: 9:264/282 of query aligns to 1:265/291 of Q8Y9N5
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
31% identity, 90% coverage: 12:264/282 of query aligns to 1:262/288 of 3tnlA
- binding nicotinamide-adenine-dinucleotide: M71 (≠ V83), G134 (= G147), A135 (= A148), G136 (= G149), G137 (= G150), A138 (= A151), N158 (vs. gap), R159 (= R170), D161 (≠ N172), F163 (vs. gap), T207 (≠ S211), V209 (≠ L213), M211 (= M215), F214 (vs. gap), V235 (= V237), Y237 (≠ T239), M261 (= M263), M262 (≠ F264)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (≠ V34), S25 (= S36), N68 (≠ I80), S70 (≠ T82), K74 (= K86), N95 (= N107), D110 (= D123)
Sites not aligning to the query:
1npdB X-ray structure of shikimate dehydrogenase complexed with NAD+ from e.Coli (ydib) northeast structural genomics research consortium (nesg) target er24 (see paper)
29% identity, 86% coverage: 22:264/282 of query aligns to 8:259/288 of 1npdB
- binding nicotinamide-adenine-dinucleotide: A132 (= A148), G133 (= G149), G134 (= G150), A135 (= A151), N155 (≠ D168), R156 (≠ V169), D158 (= D171), F160 (≠ D173), T204 (≠ S211), K205 (≠ P212), V206 (≠ L213), M208 (= M215), C232 (≠ V237), M258 (= M263), L259 (≠ F264)
P0A6D5 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Escherichia coli (strain K12) (see 4 papers)
29% identity, 86% coverage: 22:264/282 of query aligns to 8:259/288 of P0A6D5
- S22 (= S36) mutation to A: Kinetically unchanged as compared with the wild-type.
- Y39 (≠ V53) mutation to F: Kinetically unchanged as compared with the wild-type.
- S67 (≠ T82) mutation to A: Reduces activity towards quinate about 6-fold, but has a little effect on shikimate conversion.
- K71 (= K86) mutation to A: 3200-fold decrease in the affinity for quinate. 170-fold decrease in the affinity for shikimate.; mutation to G: 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- N92 (= N107) mutation to A: Alters protein structure. Loss of activity for both substrates.
- T106 (≠ F122) mutation to A: 2000-fold decrease in the affinity for quinate. 70-fold decrease in the affinity for shikimate. 10-fold greater reduction in catalytic efficiency is observed with quinate than with shikimate.
- D107 (= D123) mutation to A: Loss of activity towards quinate. 20000-fold decrease in the affinity for shikimate.
- AGGA 132:135 (= AGGA 148:151) binding
- NRRD 155:158 (≠ DVRD 168:171) binding
- K205 (≠ P212) binding
- CVYN 232:235 (≠ VVTK 237:240) binding
- G255 (= G260) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 262 Q→A: 3-fold reduction in catalytic efficiency for both substrates.
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
29% identity, 86% coverage: 22:264/282 of query aligns to 2:253/280 of 1o9bA
- binding 1,4-dihydronicotinamide adenine dinucleotide: A126 (= A148), G127 (= G149), G128 (= G150), A129 (= A151), R150 (≠ V169), F154 (≠ D173), K199 (≠ P212), V200 (≠ L213), M202 (= M215), C226 (≠ V237), Y228 (≠ T239), M252 (= M263), L253 (≠ F264)
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
26% identity, 88% coverage: 17:264/282 of query aligns to 2:239/267 of 2hk9B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V67 (= V83), G130 (= G147), G133 (= G150), A134 (= A151), N153 (≠ D171), R154 (≠ N172), T155 (≠ D173), K158 (≠ R176), T188 (≠ S211), S189 (≠ P212), V190 (≠ L213), I214 (≠ V237), M238 (= M263), L239 (≠ F264)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (≠ V34), S21 (= S36), N64 (≠ I80), T66 (= T82), K70 (= K86), N91 (= N107), D106 (= D123), Y216 (≠ T239), L239 (≠ F264)
Sites not aligning to the query:
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
26% identity, 88% coverage: 17:264/282 of query aligns to 2:239/269 of 2hk9A
- binding 2'-monophosphoadenosine-5'-diphosphate: V67 (= V83), G132 (= G149), G133 (= G150), A134 (= A151), N153 (≠ D171), R154 (≠ N172), T155 (≠ D173), T188 (≠ S211), S189 (≠ P212), V190 (≠ L213)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (≠ V34), S21 (= S36), N64 (≠ I80), K70 (= K86), N91 (= N107), D106 (= D123), Y216 (≠ T239), L239 (≠ F264)
Sites not aligning to the query:
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
26% identity, 88% coverage: 17:264/282 of query aligns to 2:239/269 of O67049
Sites not aligning to the query:
3jyqA Quinate dehydrogenase from corynebacterium glutamicum in complex with shikimate and nadh (see paper)
38% identity, 66% coverage: 77:263/282 of query aligns to 63:253/282 of 3jyqA
- binding nicotinamide-adenine-dinucleotide: V132 (= V146), G135 (= G149), G136 (= G150), V137 (≠ A151), D157 (= D171), L158 (≠ N172), R162 (= R176), T201 (≠ S211), P202 (= P212), M205 (= M215), V227 (= V237)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: N66 (≠ I80), T68 (= T82), N93 (= N107), D109 (= D123)
Sites not aligning to the query:
3jypA Quinate dehydrogenase from corynebacterium glutamicum in complex with quinate and nadh (see paper)
38% identity, 66% coverage: 77:263/282 of query aligns to 63:253/282 of 3jypA
- binding nicotinamide-adenine-dinucleotide: V132 (= V146), G135 (= G149), V137 (≠ A151), D157 (= D171), L158 (≠ N172), R162 (= R176), T201 (≠ S211), P202 (= P212), M205 (= M215), A212 (≠ P222), V227 (= V237), Y229 (≠ T239)
- binding (1S,3R,4S,5R)-1,3,4,5-tetrahydroxycyclohexanecarboxylic acid: N66 (≠ I80), T68 (= T82), K72 (= K86), N93 (= N107), D109 (= D123)
Sites not aligning to the query:
3jyoA Quinate dehydrogenase from corynebacterium glutamicum in complex with NAD (see paper)
38% identity, 66% coverage: 77:263/282 of query aligns to 63:253/282 of 3jyoA
- binding nicotinamide-adenine-dinucleotide: V132 (= V146), G135 (= G149), V137 (≠ A151), D157 (= D171), L158 (≠ N172), R162 (= R176), T201 (≠ S211), P202 (= P212), M205 (= M215), V227 (= V237), Y229 (≠ T239)
Sites not aligning to the query:
Q9X5C9 Quinate/shikimate dehydrogenase (NAD(+)); QSDH; EC 1.1.1.-; EC 1.1.1.24 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
38% identity, 66% coverage: 77:263/282 of query aligns to 64:254/283 of Q9X5C9
- T69 (= T82) binding ; binding
- K73 (= K86) active site, Proton acceptor; binding ; binding
- N94 (= N107) binding ; binding
- D110 (= D123) binding ; binding
- GV 137:138 (≠ GA 150:151) binding
- D158 (= D171) binding
- R163 (= R176) binding
- PMGM 203:206 (≠ PLGM 212:215) binding
- A213 (≠ P222) binding
- V228 (= V237) binding
- G251 (= G260) binding
Sites not aligning to the query:
- 17 binding
- 17:19 binding
- 258 binding ; binding
Q9KVT3 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
31% identity, 82% coverage: 26:255/282 of query aligns to 10:235/278 of Q9KVT3
Sites not aligning to the query:
3pgjA 2.49 angstrom resolution crystal structure of shikimate 5- dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate
31% identity, 82% coverage: 26:255/282 of query aligns to 6:231/272 of 3pgjA
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S14 (≠ V34), S16 (= S36), N59 (≠ I80), T61 (= T82), K65 (= K86), N86 (= N107), D102 (= D123)
Sites not aligning to the query:
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
29% identity, 88% coverage: 17:264/282 of query aligns to 2:251/282 of Q58484
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
29% identity, 88% coverage: 17:264/282 of query aligns to 7:256/287 of 1nvtB
- active site: K75 (= K86), D111 (= D123)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I72 (≠ V83), G135 (= G147), G137 (= G149), G138 (= G150), A139 (= A151), N157 (≠ V169), R158 (= R170), T159 (≠ D171), K162 (≠ D173), A200 (= A210), T201 (≠ S211), P202 (= P212), I203 (≠ L213), M205 (= M215), L229 (≠ V237), Y231 (≠ T239), M255 (= M263), L256 (≠ F264)
- binding zinc ion: E22 (≠ A32), H23 (≠ Q33)
Query Sequence
>BPHYT_RS30065 FitnessBrowser__BFirm:BPHYT_RS30065
MTQSDASSFSTSLDEGLSGATRVVFIVGDPIAQVRSPSGVTAALRAAGRDALVVPAHVAP
ADLPAFFAGVTPMRNVDGVIITVPHKFSAIKYCGSLTEQASFLGAVNTLRRTADGNWHGG
MFDGTGFVAALVDAGCDLRGKHALLVGAGGAGCAIGHALVQGGVASLDVRDNDAERTASL
IGRLNALRQGEVRSAAASVDASTYDVVINASPLGMRADDPLPLDVSRLPATTFVGDVVTK
PPLTPLIEAARARGCPTVTGTQMFGRVCDRMVAFLLDAERFN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory