SitesBLAST
Comparing BPHYT_RS30200 FitnessBrowser__BFirm:BPHYT_RS30200 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
25% identity, 86% coverage: 27:390/424 of query aligns to 3:351/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I31), G8 (= G32), G10 (= G34), V11 (≠ F35), I12 (≠ T36), V30 (≠ L54), E31 (≠ D55), K32 (≠ A56), E38 (≠ G62), A39 (= A63), S40 (= S64), A43 (≠ N67), G45 (= G69), L46 (≠ Q70), V171 (= V206), G200 (≠ T234), G201 (= G235), W203 (≠ S237), G298 (= G340), R300 (≠ V342), P301 (≠ D343), Y326 (≠ S365), R327 (≠ G366), N328 (≠ H367), G329 (= G368), I330 (≠ T369)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
22% identity, 88% coverage: 14:387/424 of query aligns to 13:370/383 of 5i39A
- active site: F66 (≠ N67), Q69 (= Q70), A70 (≠ V71), Q248 (≠ S263), P267 (≠ L282)
- binding flavin-adenine dinucleotide: V30 (≠ I31), G31 (= G32), G33 (= G34), I34 (≠ F35), L35 (≠ T36), V53 (≠ L54), E54 (≠ D55), K55 (≠ A56), Q62 (≠ A63), S63 (= S64), F66 (≠ N67), Y67 (≠ G68), Q69 (= Q70), A196 (= A205), A197 (≠ V206), G226 (≠ T234), G227 (= G235), W229 (= W244), Q248 (≠ S263), Q250 (≠ E265), G321 (= G340), M323 (≠ V342), T348 (≠ S365), G349 (= G366), W350 (≠ H367), G351 (= G368), M352 (≠ T369), T353 (≠ Q370)
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
27% identity, 49% coverage: 189:395/424 of query aligns to 157:358/369 of S5FMM4
- S202 (≠ T234) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ T369) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (= M379) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
25% identity, 52% coverage: 14:235/424 of query aligns to 5:219/433 of 5hxwA
- active site: F58 (≠ N67), Q61 (= Q70), A62 (≠ V71)
- binding flavin-adenine dinucleotide: V22 (≠ I31), G23 (= G32), G25 (= G34), I26 (≠ F35), L27 (≠ T36), E46 (≠ D55), K47 (≠ A56), E53 (≠ G62), Q54 (≠ A63), S55 (= S64), R57 (= R66), F58 (≠ N67), Y59 (≠ G68), G60 (= G69), Q61 (= Q70), A188 (= A205), A189 (≠ V206), G218 (≠ T234), G219 (= G235)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 221, 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
24% identity, 48% coverage: 191:392/424 of query aligns to 159:355/369 of O31616
- V174 (= V206) binding
- H244 (≠ Y286) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (≠ V342) binding
- 327:333 (vs. 364:370, 14% identical) binding
- R329 (≠ G366) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
24% identity, 48% coverage: 190:392/424 of query aligns to 158:355/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ R288), R302 (≠ V342), R329 (≠ G366)
- binding flavin-adenine dinucleotide: V174 (= V206), S202 (≠ T234), G203 (= G235), W205 (≠ S237), F209 (≠ Y245), G300 (= G340), R302 (≠ V342), H327 (≠ Y364), R329 (≠ G366), N330 (≠ H367), G331 (= G368), I332 (≠ T369)
- binding phosphate ion: R254 (= R294)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
24% identity, 48% coverage: 191:392/424 of query aligns to 159:355/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (≠ A205), V174 (= V206), S202 (≠ T234), G203 (= G235), W205 (≠ S237), F209 (≠ Y245), G300 (= G340), R302 (≠ V342), H327 (≠ Y364), F328 (≠ S365), R329 (≠ G366), N330 (≠ H367), G331 (= G368), I332 (≠ T369)
- binding glycolic acid: Y246 (≠ R288), R302 (≠ V342), R329 (≠ G366)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
8p84B X-ray structure of thermoanaerobacterales bacterium monoamine oxidase (see paper)
28% identity, 51% coverage: 25:240/424 of query aligns to 3:268/450 of 8p84B
- binding flavin-adenine dinucleotide: V9 (≠ I31), G10 (= G32), G12 (= G34), A14 (≠ T36), E33 (≠ D55), A34 (= A56), R35 (vs. gap), G40 (= G61), R41 (≠ G62), T42 (≠ A63), G56 (= G69), Q57 (= Q70), W58 (≠ N72), V234 (= V206), V262 (≠ T234)
- binding magnesium ion: E125 (≠ R110), H188 (≠ Q164)
Sites not aligning to the query:
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
25% identity, 67% coverage: 106:387/424 of query aligns to 78:357/377 of Q5L2C2
- V180 (= V206) binding
- R309 (≠ V342) binding
- 334:340 (vs. 364:370, 14% identical) binding
- R336 (≠ G366) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
27% identity, 45% coverage: 198:387/424 of query aligns to 170:355/370 of 4yshA
- active site: I262 (≠ F297), L283 (= L318), G305 (= G340), N335 (≠ H367), L338 (≠ Q370)
- binding flavin-adenine dinucleotide: V178 (= V206), S206 (≠ T234), G207 (= G235), W209 (vs. gap), R307 (≠ V342), H332 (≠ Y364), R334 (≠ G366), N335 (≠ H367), G336 (= G368), I337 (≠ T369)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
28% identity, 45% coverage: 198:387/424 of query aligns to 170:355/368 of 4yshB
- active site: I262 (≠ F297), L283 (= L318), G305 (= G340), N335 (≠ H367), L338 (≠ Q370)
- binding flavin-adenine dinucleotide: V178 (= V206), S206 (≠ T234), W209 (= W244), R307 (≠ V342), H332 (≠ Y364), R334 (≠ G366), N335 (≠ H367), G336 (= G368), I337 (≠ T369), L338 (≠ Q370)
- binding glycine: G249 (≠ Y286), Y251 (≠ R288), Y251 (≠ R288), A264 (≠ G299), R307 (≠ V342), R334 (≠ G366), R334 (≠ G366)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
26% identity, 53% coverage: 10:235/424 of query aligns to 10:225/824 of Q8GAI3
- W66 (≠ G65) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ R66) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
21% identity, 84% coverage: 41:397/424 of query aligns to 20:362/374 of 1y56B
- active site: F44 (≠ G65), G47 (= G68), T48 (= T73), H224 (≠ R247), P239 (= P264), G305 (= G340), M338 (≠ Q370)
- binding flavin-adenine dinucleotide: I33 (≠ L54), E34 (≠ D55), K35 (≠ A56), S42 (≠ A63), T43 (≠ S64), R45 (= R66), C46 (≠ N67), G47 (= G68), G49 (= G74), E170 (≠ A205), V171 (= V206), T200 (= T234), N201 (vs. gap), W203 (vs. gap), G305 (= G340), Y306 (≠ L341), Y307 (≠ V342), G334 (= G366), H335 (= H367), G336 (= G368), F337 (≠ T369), M338 (≠ Q370)
- binding flavin mononucleotide: F44 (≠ G65), R45 (= R66), I260 (≠ A276), R301 (≠ Y336), W303 (= W338)
Sites not aligning to the query:
5fjnA Structure of l-amino acid deaminase from proteus myxofaciens in complex with anthranilate (see paper)
24% identity, 52% coverage: 14:235/424 of query aligns to 17:231/447 of 5fjnA
- active site: S67 (= S64), Y71 (≠ G68), S72 (≠ G69)
- binding flavin-adenine dinucleotide: I34 (= I31), G35 (= G32), G37 (= G34), I38 (≠ F35), Q39 (≠ T36), L57 (= L54), E58 (≠ D55), K59 (≠ A56), E65 (≠ G62), Q66 (≠ A63), S67 (= S64), A70 (≠ N67), Y71 (≠ G68), S72 (≠ G69), Q73 (= Q70), V201 (= V206), G230 (≠ T234), G231 (= G235)
Sites not aligning to the query:
- active site: 252
- binding 2-aminobenzoic acid: 252, 289, 411, 412
- binding flavin-adenine dinucleotide: 233, 252, 254, 343, 385, 410, 411, 412, 413, 414, 415
5fjmA Structure of l-amino acid deaminase from proteus myxofaciens (see paper)
24% identity, 52% coverage: 14:235/424 of query aligns to 17:231/447 of 5fjmA
- active site: S67 (= S64), Y71 (≠ G68), S72 (≠ G69)
- binding flavin-adenine dinucleotide: I34 (= I31), G35 (= G32), G37 (= G34), I38 (≠ F35), Q39 (≠ T36), L57 (= L54), E58 (≠ D55), K59 (≠ A56), E65 (≠ G62), Q66 (≠ A63), S67 (= S64), A70 (≠ N67), Y71 (≠ G68), S72 (≠ G69), Q73 (= Q70), V201 (= V206), G230 (≠ T234), G231 (= G235)
Sites not aligning to the query:
- active site: 252
- binding flavin-adenine dinucleotide: 233, 252, 254, 343, 385, 410, 411, 412, 413, 414, 415
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
22% identity, 71% coverage: 51:350/424 of query aligns to 49:337/405 of P40875
- C146 (vs. gap) mutation to S: No change in activity.
- H173 (≠ M182) modified: Tele-8alpha-FMN histidine; mutation to N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- H175 (≠ K184) mutation to A: No effect on FMN binding and activity.
- C195 (≠ A204) mutation to S: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
- 351 C→A: No change in activity.
Query Sequence
>BPHYT_RS30200 FitnessBrowser__BFirm:BPHYT_RS30200
MKLDSYWLDTAPPLLSASEGPLDGQTDVVVIGGGFTGLSAAQALGKRGAAVTVLDAGRIG
GGASGRNGGQVNTGVAQDFVALVAQLGVERASACYRAFSDAVDTVERLIREENIDCNYIA
TGKLKLASKPHHLAHLEKTAEAIRREVDTDIELIDRSRIRSEIQSDSFHGGLLQRHGGQM
HMGKFTVGLAEAAVRRGAKLYENAAVTAIAKDGNGYRITTARGEVRAKQVLIATGPSRHG
PFGWYRRRLAPVGSFIVVTEPLSPELLAQVFPNRRAYTTTRLMHNYFRVTPDSRLLFGGR
ARFTASERPSDAKSGRILQEGLAAMFPTLASARIDYCWGGLVDMSADRLPHAGQHDGIYF
SMGYSGHGTQMSTHMGQVMADVMDGHEDKNPWRESEWPAIPGHTGKPWFLPLVGTYYRIK
DIFY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory