SitesBLAST
Comparing BPHYT_RS30215 FitnessBrowser__BFirm:BPHYT_RS30215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
45% identity, 89% coverage: 35:308/308 of query aligns to 42:315/315 of 5vg6B
- active site: M98 (≠ I91), R230 (= R223), D254 (= D247), E259 (= E252), H278 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A67), R92 (= R85), M102 (= M95), L147 (= L140), G148 (= G141), D149 (≠ V142), L150 (= L143), W168 (= W161), S169 (= S162), R170 (= R163), T171 (≠ S164), K173 (≠ R166), L201 (= L194), P202 (= P195), T207 (= T200), V228 (≠ T221), R230 (= R223), H278 (= H271), A280 (= A273), S281 (= S274), Y315 (= Y308)
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
40% identity, 95% coverage: 15:308/308 of query aligns to 16:313/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A66 (= A67), R90 (= R85), M100 (= M95), A145 (≠ L140), G146 (= G141), V147 (= V142), L148 (= L143), W166 (= W161), S167 (= S162), R168 (= R163), T169 (≠ S164), K171 (≠ R166), L199 (= L194), P200 (= P195), L226 (≠ T221), A227 (≠ G222), R228 (= R223), D252 (= D247), H276 (= H271), A279 (≠ S274), Y313 (= Y308)
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
40% identity, 95% coverage: 15:308/308 of query aligns to 15:312/312 of 7jqiA
- binding 2-oxoglutaric acid: G64 (= G66), A65 (= A67), G66 (= G68), R227 (= R223), H275 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A67), R89 (= R85), M99 (= M95), A144 (≠ L140), G145 (= G141), V146 (= V142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), T168 (≠ S164), K170 (≠ R166), L198 (= L194), P199 (= P195), L225 (≠ T221), R227 (= R223), H275 (= H271), A278 (≠ S274), Y312 (= Y308)
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
40% identity, 95% coverage: 15:308/308 of query aligns to 15:312/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A67), R89 (= R85), M99 (= M95), A144 (≠ L140), G145 (= G141), V146 (= V142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), T168 (≠ S164), K170 (≠ R166), L198 (= L194), P199 (= P195), L225 (≠ T221), R227 (= R223), H275 (= H271), A277 (= A273), A278 (≠ S274), Y312 (= Y308)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: W15 (= W15), A65 (= A67), R227 (= R223), H275 (= H271), T280 (= T276)
Sites not aligning to the query:
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
39% identity, 100% coverage: 1:308/308 of query aligns to 1:312/312 of 3kboA
- active site: M95 (≠ I91), R227 (= R223), E256 (= E252), H275 (= H271)
- binding N-(2-hydroxyethyl)-N,N-dimethyl-3-sulfopropan-1-aminium: N36 (≠ P37), A53 (≠ T55), R55 (≠ P57), R56 (≠ N58)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R85), M99 (= M95), G143 (= G139), A144 (≠ L140), G145 (= G141), V146 (= V142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), S168 (= S164), K170 (≠ R166), L197 (= L193), P199 (= P195), L225 (≠ T221), A226 (≠ G222), R227 (= R223), D251 (= D247), H275 (= H271), A278 (≠ S274), Y312 (= Y308)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
39% identity, 100% coverage: 1:308/308 of query aligns to 7:316/316 of 4zqbB
- active site: L99 (≠ I91), R231 (= R223), E260 (= E252), H279 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (= R85), M103 (= M95), G147 (= G139), L148 (= L140), G149 (= G141), E150 (≠ V142), L151 (= L143), W169 (= W161), S170 (= S162), R171 (= R163), S172 (= S164), K174 (≠ R166), L202 (= L194), P203 (= P195), F229 (≠ T221), R231 (= R223), H279 (= H271), S281 (≠ A273), A282 (≠ S274), Y316 (= Y308)
5tsdA Crystal structure of NADPH-dependent 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH and oxalate
38% identity, 89% coverage: 36:308/308 of query aligns to 40:316/316 of 5tsdA
- active site: E260 (= E252), H279 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A71 (= A67), R89 (= R85), M99 (= M95), G143 (= G139), L144 (= L140), G145 (= G141), I146 (≠ V142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), T168 (≠ S164), K170 (≠ R166), L197 (= L194), P198 (= P195), A229 (≠ T221), G230 (= G222), R231 (= R223), D255 (= D247), H279 (= H271), Y316 (= Y308)
- binding oxalic acid: W50 (= W46), G70 (= G66), A71 (= A67), G72 (= G68), R231 (= R223), H279 (= H271)
5bqfA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADP, hepes and l(+)-tartaric acid
38% identity, 89% coverage: 36:308/308 of query aligns to 41:317/317 of 5bqfA
- active site: E261 (= E252), H280 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A72 (= A67), R90 (= R85), M100 (= M95), G144 (= G139), L145 (= L140), G146 (= G141), I147 (≠ V142), L148 (= L143), W166 (= W161), S167 (= S162), R168 (= R163), T169 (≠ S164), L198 (= L194), P199 (= P195), A230 (≠ T221), G231 (= G222), R232 (= R223), H280 (= H271), A283 (≠ S274), Y317 (= Y308)
4xcvA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH
38% identity, 89% coverage: 36:308/308 of query aligns to 41:317/317 of 4xcvA
- active site: E261 (= E252), H280 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A72 (= A67), R90 (= R85), M100 (= M95), G144 (= G139), L145 (= L140), G146 (= G141), I147 (≠ V142), L148 (= L143), W166 (= W161), S167 (= S162), R168 (= R163), T169 (≠ S164), K171 (≠ R166), L198 (= L194), P199 (= P195), A230 (≠ T221), G231 (= G222), R232 (= R223), H280 (= H271), A283 (≠ S274), Y317 (= Y308)
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
40% identity, 90% coverage: 33:308/308 of query aligns to 30:316/316 of 4z0pA
- active site: L95 (≠ I91), R231 (= R223), G250 (≠ R242), D255 (= D247), E260 (= E252), H279 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R85), M99 (= M95), M144 (≠ L140), G145 (= G141), V146 (= V142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), S168 (= S164), R170 (= R166), L197 (= L194), P198 (= P195), A229 (≠ T221), G230 (= G222), R231 (= R223), H279 (= H271), A281 (= A273), A282 (≠ S274), Y316 (= Y308)
- binding oxalic acid: W50 (= W46), G70 (= G66), A71 (= A67), G72 (= G68), H114 (≠ L110), R115 (≠ F111), R231 (= R223), H279 (= H271)
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
40% identity, 90% coverage: 33:308/308 of query aligns to 30:316/316 of 4weqA
- active site: L95 (≠ I91), R231 (= R223), G250 (≠ R242), D255 (= D247), E260 (= E252), H279 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (= R85), M99 (= M95), M144 (≠ L140), G145 (= G141), V146 (= V142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), S168 (= S164), R170 (= R166), L197 (= L194), P198 (= P195), A229 (≠ T221), G230 (= G222), R231 (= R223), D255 (= D247), H279 (= H271), A281 (= A273), Y316 (= Y308)
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
33% identity, 80% coverage: 56:302/308 of query aligns to 56:307/308 of 5mhaB
- binding 2-Ketohexanoic acid: R66 (≠ G66), R226 (= R223), H274 (= H271), Y282 (vs. gap)
- binding (2R)-2-hydroxyhexanoic acid: R66 (≠ G66), A67 (= A67), G68 (= G68), H91 (≠ V92), Y282 (vs. gap)
- binding magnesium ion: F212 (= F209), E213 (≠ A210), M215 (≠ L212), D243 (≠ Q240)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A67), G68 (= G68), T88 (≠ P89), L143 (= L140), G144 (= G141), T145 (≠ V142), L146 (= L143), R165 (≠ S162), R166 (= R163), S167 (= S164), P180 (≠ E177), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ T221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
33% identity, 80% coverage: 56:302/308 of query aligns to 56:307/308 of 5mhaA
- binding 2-Ketohexanoic acid: R66 (≠ G66), A67 (= A67), G68 (= G68), H91 (≠ V92), R226 (= R223), H274 (= H271), Y282 (vs. gap)
- binding magnesium ion: T132 (≠ K128), A134 (= A130)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A67), G68 (= G68), T88 (≠ P89), L143 (= L140), G144 (= G141), T145 (≠ V142), L146 (= L143), R165 (≠ S162), R166 (= R163), S167 (= S164), P180 (≠ E177), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ T221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
33% identity, 80% coverage: 56:302/308 of query aligns to 56:307/308 of 5mh5A
- binding 2-Ketohexanoic acid: R66 (≠ G66), A67 (= A67), G68 (= G68), H91 (≠ V92), R226 (= R223), H274 (= H271), Y282 (vs. gap)
- binding magnesium ion: T132 (≠ K128), A134 (= A130), F212 (= F209), E213 (≠ A210), M215 (≠ L212), D243 (≠ Q240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A67 (= A67), G68 (= G68), T88 (≠ P89), G142 (= G139), L143 (= L140), G144 (= G141), T145 (≠ V142), L146 (= L143), R165 (≠ S162), R166 (= R163), S167 (= S164), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ T221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
33% identity, 80% coverage: 56:302/308 of query aligns to 54:305/306 of 5mh6A
- binding 2-Ketohexanoic acid: R64 (≠ G66), A65 (= A67), G66 (= G68), H89 (≠ V92), R224 (= R223), H272 (= H271), Y280 (vs. gap)
- binding magnesium ion: T130 (≠ K128), A132 (= A130), F210 (= F209), E211 (≠ A210), M213 (≠ L212), G225 (= G224), P226 (= P225), V228 (≠ L227), E230 (≠ Q229), D241 (≠ Q240), S251 (≠ D250)
- binding nicotinamide-adenine-dinucleotide: A65 (= A67), G66 (= G68), T86 (≠ P89), H89 (≠ V92), G142 (= G141), T143 (≠ V142), L144 (= L143), R164 (= R163), P196 (= P195), T201 (= T200), V222 (≠ T221), A223 (≠ G222), R224 (= R223), H272 (= H271), S274 (≠ A273)
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
33% identity, 78% coverage: 58:298/308 of query aligns to 70:318/324 of 2gcgA
- active site: L103 (≠ I91), R241 (= R223), D265 (= D247), E270 (= E252), H289 (= H271)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (≠ G66), V79 (≠ A67), G80 (= G68), R241 (= R223), H289 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (≠ A67), T107 (≠ M95), G156 (= G139), G158 (= G141), I160 (≠ L143), G180 (vs. gap), R181 (= R163), R184 (= R166), C212 (≠ L194), S213 (≠ P195), T218 (= T200), I239 (≠ T221), R241 (= R223), D265 (= D247), H289 (= H271), G291 (≠ A273)
Sites not aligning to the query:
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
33% identity, 78% coverage: 58:298/308 of query aligns to 74:322/328 of Q9UBQ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
30% identity, 79% coverage: 56:299/308 of query aligns to 63:307/311 of 3bazA
- active site: L98 (≠ I91), R230 (= R223), A251 (= A244), D254 (= D247), E259 (= E252), H277 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ A67), G149 (= G139), L150 (= L140), G151 (= G141), R152 (≠ V142), I153 (≠ L143), S172 (= S162), R173 (= R163), S174 (= S164), C201 (≠ L194), P202 (= P195), T207 (= T200), I228 (≠ T221), G229 (= G222), R230 (= R223), D254 (= D247), H277 (= H271), G279 (≠ A273)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
30% identity, 79% coverage: 56:299/308 of query aligns to 65:309/313 of Q65CJ7
6ttbA Crystal structure of NAD-dependent formate dehydrogenase from staphylococcus aureus in complex with NAD
26% identity, 92% coverage: 11:293/308 of query aligns to 34:319/331 of 6ttbA
- binding nicotinamide-adenine-dinucleotide: V87 (≠ A67), N111 (≠ G90), V115 (≠ M95), F162 (≠ L138), G165 (= G141), R166 (≠ V142), I167 (≠ L143), Y185 (≠ W161), D186 (≠ S162), P187 (≠ R163), H214 (≠ L193), A215 (≠ L194), P216 (= P195), T221 (= T200), T242 (= T221), A243 (≠ G222), R244 (= R223), H292 (= H271), S294 (≠ A273), G295 (≠ S274)
Query Sequence
>BPHYT_RS30215 FitnessBrowser__BFirm:BPHYT_RS30215
MAFLYKADPARGAQWAKLFAQKAPELPFHIWPDLGDPAAVRYLAAWQPPEDPTRTFPNLE
VVFSVGAGIDQFDLSGVPEHVPVVRMIEPGIVEGMVEYVTQAVLTIHRDLFDYGLQQQQQ
VWHELPLKPASQRRVGVLGLGVLGTAVLERLRLFGFDCAGWSRSLREIEGVACYAGEGAL
DAFLARTDILICLLPLTPATRGLLDAQLFAKLPRGASLIQTGRGPHLNQQDLLAALESGQ
LRNAILDVTDPEPLPAGHPLWTHPRVRITPHIASATRPDTAVDVVLENLRRHREGLPMLG
QVDRVQGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory