SitesBLAST
Comparing BPHYT_RS30250 FitnessBrowser__BFirm:BPHYT_RS30250 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
49% identity, 94% coverage: 6:432/452 of query aligns to 11:439/448 of Q51955
- D41 (= D36) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D39) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G80) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D84) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G87) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R119) mutation to A: Abolishes 4-HBA transport.
- E144 (= E139) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R178) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D316) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ N321) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (= R379) mutation to A: Strong decrease in 4-HBA transport.
- R398 (= R391) mutation to A: Abolishes 4-HBA transport.
Sites not aligning to the query:
- 444 H→A: No change in 4-HBA transport and chemotaxis.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
41% identity, 95% coverage: 4:431/452 of query aligns to 2:429/452 of Q5EXK5
- D82 (= D84) mutation to A: Loss of activity.
- V311 (= V313) mutation to W: Loss of activity.
- D314 (= D316) mutation to A: Loss of activity.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
31% identity, 91% coverage: 28:439/452 of query aligns to 19:397/403 of P77589
- E27 (≠ D36) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
- D75 (= D84) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (≠ V313) mutation to H: 30% increase in 3HPP transport activity.
- K276 (≠ R317) mutation to D: Lack of 3HPP transport activity.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
29% identity, 81% coverage: 30:395/452 of query aligns to 48:390/444 of Q8NLB7
- D54 (= D36) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D39) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R85) mutation to A: Loss of transport activity.
- W309 (≠ V313) mutation to V: Loss of transport activity.
- D312 (= D316) mutation to A: Loss of transport activity.
- R313 (= R317) mutation to A: Loss of transport activity.
- I317 (≠ N321) mutation I->H,Y: Loss of transport activity.
- R386 (= R391) mutation to A: Loss of transport activity.
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
24% identity, 65% coverage: 22:316/452 of query aligns to 14:301/430 of P0AA76
- Y29 (≠ G37) binding
- D31 (= D39) mutation to N: Loss of galactonate transport activity.
- R32 (≠ T40) binding
- Y64 (≠ L72) binding
- E118 (≠ L126) mutation to Q: Loss of galactonate transport activity.
Sites not aligning to the query:
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
24% identity, 65% coverage: 22:316/452 of query aligns to 3:282/409 of 6e9nA
Sites not aligning to the query:
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 46% coverage: 6:214/452 of query aligns to 149:369/742 of Q02563
- DMCLS 196:200 (≠ EWGIT 53:57) mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
- 321:331 (vs. 178:178, 0% identical) mutation Missing: No change in uptake of BoNT/D or BoNT/E.
Sites not aligning to the query:
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
28% identity, 40% coverage: 22:200/452 of query aligns to 6:185/393 of 6e9oA
Sites not aligning to the query:
Q9NSA0 Solute carrier family 22 member 11; Organic anion transporter 4; OAT4; Organic anion:dicarboxylate exchanger OAT4 from Homo sapiens (Human) (see 3 papers)
28% identity, 39% coverage: 49:224/452 of query aligns to 127:303/550 of Q9NSA0
- G241 (= G160) mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
Sites not aligning to the query:
- 39 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface location; when associated with Q-56; Q-63 and Q-99.
- 47 H→A: Reduced cell surface expression and estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-52; A-83; A-305 and A-469.
- 52 H→A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-83; A-305 and A-469.
- 56 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-63 and Q-99.
- 63 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-99.
- 83 H→A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-305 and A-469.
- 99 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-63.
- 305 H→A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-469.
- 400 mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
- 469 H→A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-305.
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
24% identity, 46% coverage: 6:214/452 of query aligns to 135:355/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
24% identity, 46% coverage: 6:214/452 of query aligns to 135:355/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
O57379 Solute carrier family 22 member 6; Organic anion transporter 1; Renal organic anion transporter 1; ROAT1; fROAT1 from Pseudopleuronectes americanus (Winter flounder) (Pleuronectes americanus) (see paper)
31% identity, 35% coverage: 71:230/452 of query aligns to 156:313/562 of O57379
Sites not aligning to the query:
- 34 H→I: Reduced transport activity.
- 394 K→A: Reduced transport activity.
- 478 R→D: Reduced transport activity.
Q497L9 Solute carrier family 22 member 14 from Mus musculus (Mouse) (see paper)
24% identity, 78% coverage: 35:388/452 of query aligns to 148:509/629 of Q497L9
- H275 (≠ F154) mutation to A: Strongly reduced riboflavin transport; when associated with 391-A--A-394.
- SYIS 391:394 (≠ SINW 276:279) mutation to AYIA: Strongly reduced riboflavin transport; when associated with A-275.
4zp0A Crystal structure of e. Coli multidrug transporter mdfa in complex with deoxycholate (see paper)
51% identity, 10% coverage: 80:126/452 of query aligns to 65:111/392 of 4zp0A
Sites not aligning to the query:
4zowA Crystal structure of e. Coli multidrug transporter mdfa in complex with chloramphenicol (see paper)
51% identity, 10% coverage: 80:126/452 of query aligns to 64:110/391 of 4zowA
Sites not aligning to the query:
6oopA Protein b (see paper)
51% identity, 10% coverage: 80:126/452 of query aligns to 65:111/392 of 6oopA
Sites not aligning to the query:
P0AEY8 Multidrug transporter MdfA; Chloramphenicol resistance pump Cmr from Escherichia coli (strain K12) (see paper)
51% identity, 10% coverage: 80:126/452 of query aligns to 73:119/410 of P0AEY8
Sites not aligning to the query:
- 26 E→A: Loss of ethidium bromide efflux activity.; E→D: No change in ethidium bromide efflux activity.; E→H: Almost no chloramphenicol efflux activity. Loss of ethidium bromide efflux activity.; mutation E->I,V: Slight decrease in chloramphenicol efflux activity. Exhibits low ethidium bromide efflux activity.; E→K: Decrease in TPP efflux activity. Exhibits low ethidium bromide efflux activity.; mutation E->L,N: Strong decrease in chloramphenicol efflux activity. Loss of ethidium bromide and TPP efflux activities.; E→Q: Slight decrease in chloramphenicol efflux activity. Loss of ethidium bromide efflux activity.; E→T: Strong decrease in chloramphenicol efflux activity. Loss of ethidium bromide efflux activity.
6zguA Crystal structure of a mfs transporter with bound 3-(2-methylphenyl) propanoic acid at 2.41 angstroem resolution
27% identity, 79% coverage: 45:400/452 of query aligns to 28:356/404 of 6zguA
6zgtA Crystal structure of a mfs transporter with bound 2-naphthoic acid at 2.39 angstroem resolution
27% identity, 79% coverage: 45:400/452 of query aligns to 28:356/404 of 6zgtA
6zgsA Crystal structure of a mfs transporter with bound 3-phenylpropanoic acid at 2.39 angstroem resolution
27% identity, 79% coverage: 45:400/452 of query aligns to 28:356/404 of 6zgsA
Query Sequence
>BPHYT_RS30250 FitnessBrowser__BFirm:BPHYT_RS30250
MNRSTAVNVQTFINEHPFSPFQWLVFFMCFIIVLLDGFDTAAIGFIAPSLIAEWGITRPA
LAPVLSAALFGLACGALGSGPLSDRLGRRSLLLGSVLLFGVACLGSAFSTSIEQLTTLRF
ITGVGLGAAMPNAVTMMGEYCPDRRRATVINLMFCGFPLGAAFGGFLAAWMIPHFGWRSV
LLLGGITPLLLLIVLAIKMPESVRYMVANNKPVERIRAALARISSEAAQAGSFVMTETAP
QTGGKGMAVVLSRSYIIGSVMLWIAYFMGLVIFYASINWMPILLKDAGLTPQRATLISAL
FPLGGVGAVLCGVLMDRFNANRIIAACYALTAVSVYFIGQAVGNVGALVFIVFVAGVLMN
TAQSSMPALAAAFYPTEGRGTGVAWMLGIGRFGGIAGSFLVAELTRRHFSFAGIFAMVAV
AGLLACLALLIKQAARPHVANVGAPKAESFGH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory