SitesBLAST
Comparing BPHYT_RS30440 FitnessBrowser__BFirm:BPHYT_RS30440 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
63% identity, 98% coverage: 6:253/254 of query aligns to 2:244/244 of 7krmC
- active site: G18 (= G22), S140 (= S144), Y155 (= Y159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S15 (= S19), G18 (= G22), I19 (= I23), D38 (= D42), L39 (= L43), A60 (≠ C64), N61 (= N65), V62 (= V66), N88 (= N92), V111 (= V115), S140 (= S144), Y155 (= Y159), K159 (= K163), I188 (= I192), T190 (= T194)
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
41% identity, 97% coverage: 7:252/254 of query aligns to 2:242/243 of 1q7bA
- active site: G15 (= G22), E101 (≠ S108), S137 (= S144), Q147 (≠ G156), Y150 (= Y159), K154 (= K163)
- binding calcium ion: E232 (≠ A242), T233 (≠ V243)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), S13 (≠ P20), R14 (= R21), T36 (≠ L43), N58 (= N65), V59 (= V66), N85 (= N92), A86 (= A93), G87 (= G94), I88 (= I95), S137 (= S144), Y150 (= Y159), K154 (= K163), P180 (= P189), G181 (= G190), I183 (= I192)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 97% coverage: 7:252/254 of query aligns to 3:243/244 of P0AEK2
- G--ASR 12:15 (≠ GGASPR 16:21) binding
- T37 (≠ L43) binding
- NV 59:60 (= NV 65:66) binding
- N86 (= N92) binding
- Y151 (= Y159) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSAAK 159:163) binding
- A154 (= A162) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K163) mutation to A: Defect in the affinity for NADPH.
- I184 (= I192) binding
- E233 (≠ A242) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
41% identity, 97% coverage: 7:252/254 of query aligns to 2:242/243 of 1q7cA
- active site: G15 (= G22), S137 (= S144), Q147 (≠ G156), F150 (≠ Y159), K154 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), S13 (≠ P20), R14 (= R21), A35 (≠ D42), T36 (≠ L43), L57 (≠ C64), N58 (= N65), V59 (= V66), G87 (= G94), I88 (= I95)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
39% identity, 97% coverage: 7:252/254 of query aligns to 3:243/244 of 6t77A
- active site: G16 (= G22), S138 (= S144), Y151 (= Y159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ P20), R15 (= R21), T37 (≠ L43), L58 (≠ C64), N59 (= N65), V60 (= V66), A87 (= A93), G88 (= G94), I89 (= I95)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 97% coverage: 7:252/254 of query aligns to 3:243/244 of P0A2C9
- M125 (= M131) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A232) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S233) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
40% identity, 97% coverage: 7:252/254 of query aligns to 2:242/243 of 7emgB
4nbuB Crystal structure of fabg from bacillus sp (see paper)
41% identity, 98% coverage: 4:252/254 of query aligns to 3:244/244 of 4nbuB
- active site: G18 (= G22), N111 (= N116), S139 (= S144), Q149 (≠ G156), Y152 (= Y159), K156 (= K163)
- binding acetoacetyl-coenzyme a: D93 (≠ A98), K98 (≠ D103), S139 (= S144), N146 (≠ G151), V147 (≠ L154), Q149 (≠ G156), Y152 (= Y159), F184 (≠ L191), M189 (≠ I196), K200 (≠ E208)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), N17 (≠ S19), G18 (= G22), I19 (= I23), D38 (= D42), F39 (≠ L43), V59 (≠ C64), D60 (≠ N65), V61 (= V66), N87 (= N92), A88 (= A93), G89 (= G94), I90 (= I95), T137 (≠ M142), S139 (= S144), Y152 (= Y159), K156 (= K163), P182 (= P189), F184 (≠ L191), T185 (≠ I192), T187 (= T194), M189 (≠ I196)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
39% identity, 97% coverage: 7:252/254 of query aligns to 6:242/243 of 4i08A
- active site: G19 (= G22), N113 (= N116), S141 (= S144), Q151 (≠ G156), Y154 (= Y159), K158 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ P20), R18 (= R21), I20 (= I23), T40 (≠ L43), N62 (= N65), V63 (= V66), N89 (= N92), A90 (= A93), G140 (≠ S143), S141 (= S144), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), T189 (= T194)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
39% identity, 97% coverage: 7:252/254 of query aligns to 6:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ P20), R18 (= R21), I20 (= I23), T40 (≠ L43), N62 (= N65), V63 (= V66), N89 (= N92), A90 (= A93), I92 (= I95), V139 (≠ M142), S141 (= S144), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), I187 (= I192), T189 (= T194), M191 (≠ I196)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
40% identity, 96% coverage: 10:252/254 of query aligns to 5:246/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
40% identity, 96% coverage: 10:252/254 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G22), S138 (= S144), Q148 (vs. gap), Y151 (= Y159), K155 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G16), S10 (≠ A18), R11 (= R21), I13 (= I23), N31 (≠ F41), Y32 (≠ D42), A33 (≠ L43), G34 (≠ D44), S35 (≠ E45), A58 (≠ C64), N59 (= N65), V60 (= V66), N86 (= N92), A87 (= A93), T109 (≠ V115), S138 (= S144), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
41% identity, 97% coverage: 5:250/254 of query aligns to 1:237/239 of 4nbtA
- active site: G16 (= G22), S132 (= S144), Y145 (= Y159), K149 (= K163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), K15 (≠ R21), G16 (= G22), L17 (≠ I23), D36 (= D42), L37 (= L43), L52 (≠ C64), N53 (= N65), V54 (= V66), N80 (= N92), A81 (= A93), G82 (= G94), I130 (≠ M142), S132 (= S144), Y145 (= Y159), K149 (= K163), P177 (= P189), G178 (= G190), I180 (= I192), T182 (= T194)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
40% identity, 97% coverage: 7:252/254 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G22), S142 (= S144), Q152 (≠ G156), Y155 (= Y159), K159 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ A18), R15 (= R21), G16 (= G22), I17 (= I23), N35 (≠ D42), Y36 (≠ L43), N37 (≠ D44), G38 (vs. gap), S39 (≠ E45), N63 (= N65), V64 (= V66), N90 (= N92), A91 (= A93), I93 (= I95), I113 (≠ V115), S142 (= S144), Y155 (= Y159), K159 (= K163), P185 (= P189), I188 (= I192), T190 (= T194)
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
40% identity, 96% coverage: 7:249/254 of query aligns to 7:247/251 of 6d9yB
- active site: G20 (= G22), S145 (= S144), Y158 (= Y159)
- binding nicotinamide-adenine-dinucleotide: G16 (= G16), R19 (= R21), G20 (= G22), D40 (= D42), L41 (= L43), V64 (vs. gap), D65 (vs. gap), Q66 (vs. gap), A93 (= A93), S145 (= S144), Y158 (= Y159), K162 (= K163), P188 (= P189), A189 (≠ G190), A190 (≠ L191), A191 (≠ I192), T193 (= T194)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
41% identity, 96% coverage: 7:249/254 of query aligns to 3:242/248 of Q9KJF1
- S15 (= S19) binding
- D36 (= D42) binding
- D62 (≠ N65) binding
- I63 (≠ V66) binding
- N89 (= N92) binding
- Y153 (= Y159) binding
- K157 (= K163) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
41% identity, 96% coverage: 7:249/254 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), M16 (≠ I23), D35 (= D42), I36 (≠ L43), I62 (≠ V66), N88 (= N92), G90 (= G94), I138 (≠ M142), S140 (= S144), Y152 (= Y159), K156 (= K163), I185 (= I192)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
40% identity, 98% coverage: 6:253/254 of query aligns to 2:254/256 of 7do7A
- active site: G16 (= G22), S146 (= S144), Y159 (= Y159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), R15 (= R21), G16 (= G22), I17 (= I23), S37 (≠ F41), D66 (≠ N65), A67 (≠ V66), N93 (= N92), A94 (= A93), G95 (= G94), I96 (= I95), V144 (≠ M142), S145 (= S143), S146 (= S144), Y159 (= Y159), K163 (= K163), P189 (= P189), G190 (= G190), I192 (= I192), T194 (= T194), I196 (= I196)
- binding beta-L-rhamnopyranose: F99 (≠ A98), S146 (= S144), S148 (= S146), Q156 (≠ L154), Y159 (= Y159), N197 (= N197), D235 (= D234), M236 (≠ L235), R238 (≠ S237)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
40% identity, 98% coverage: 6:253/254 of query aligns to 2:254/256 of 7b81A
- active site: G16 (= G22), S146 (= S144), Y159 (= Y159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S14 (≠ A18), R15 (= R21), I17 (= I23), D66 (≠ N65), A67 (≠ V66), N93 (= N92), A94 (= A93), G95 (= G94), I96 (= I95), T116 (≠ V115), V144 (≠ M142), S146 (= S144), Y159 (= Y159), K163 (= K163), P189 (= P189), G190 (= G190), I192 (= I192), T194 (= T194), I196 (= I196)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
38% identity, 96% coverage: 7:249/254 of query aligns to 5:251/255 of 5itvA
- active site: G18 (= G22), S141 (= S144), Y154 (= Y159), K158 (= K163)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), S17 (= S19), G18 (= G22), I19 (= I23), D38 (= D42), I39 (≠ L43), T61 (≠ C64), I63 (≠ V66), N89 (= N92), G91 (= G94), T139 (≠ M142), S141 (= S144), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), I186 (≠ L191), I187 (= I192)
Query Sequence
>BPHYT_RS30440 FitnessBrowser__BFirm:BPHYT_RS30440
MSESRLLDGKVAVISGGASPRGIGMATARKFAAHGARIAIFDLDEKAAVEAAASIGPEHR
GYVCNVTDRGACQAAVERTVADFGSIDILINNAGITQAAKFLDIDPESWDRILDVNLRGV
LYLSQAVVPQMKKQKSGSIGCMSSVSAQRGGGILGGPHYSAAKAGVLGLAKAMARELGND
GIRVNCVTPGLIQTDINAGKISDDKRVEILSGIPLNRLGVPDDVAGAFLFLASDLSSYIT
GAVIDVNGGMLIHG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory