SitesBLAST
Comparing BPHYT_RS30785 FitnessBrowser__BFirm:BPHYT_RS30785 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
42% identity, 89% coverage: 43:441/448 of query aligns to 41:434/478 of Q47945
Sites not aligning to the query:
- 1:36 signal peptide
- 37 modified: Pyrrolidone carboxylic acid
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
42% identity, 89% coverage: 43:441/448 of query aligns to 3:396/433 of 8gy2B
- binding heme c: C18 (= C58), C21 (= C61), H22 (= H62), T46 (= T86), I48 (= I88), Y59 (= Y99), L68 (= L108), R73 (≠ A113), V79 (≠ L119), Y80 (= Y120), M83 (= M123), F88 (≠ Y128), R126 (= R166), H165 (= H205), C166 (= C206), C169 (= C209), H170 (= H210), I201 (≠ Y240), A202 (= A241), P203 (= P242), L205 (= L244), W216 (= W258), F224 (≠ Y266), A234 (≠ V276), V235 (≠ A277), F236 (= F278), F236 (= F278), M239 (= M281), N301 (= N347), C302 (= C348), C305 (= C351), H306 (= H352), M316 (≠ A362), F317 (= F363), P318 (= P364), L320 (= L366), P324 (≠ A370), G342 (≠ S388), S352 (≠ T398), V354 (≠ L400), M356 (= M402), F359 (= F405), M375 (≠ V421)
- binding ubiquinone-10: C21 (= C61), L34 (= L74), P39 (= P79), P81 (= P121), L129 (≠ M169), W132 (= W172), E168 (≠ A208), R173 (≠ H213), I197 (≠ L236), D241 (≠ E283)
Sites not aligning to the query:
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
39% identity, 88% coverage: 46:441/448 of query aligns to 1:400/413 of 8jejC
- binding heme c: C13 (= C58), C16 (= C61), H17 (= H62), T42 (= T86), I44 (= I88), F60 (= F104), L64 (= L108), L75 (= L119), Y76 (= Y120), M79 (= M123), P80 (= P124), Y84 (= Y128), R122 (= R166), C162 (= C206), C165 (= C209), H166 (= H210), I186 (≠ L236), W189 (= W239), A191 (= A241), P192 (= P242), I194 (≠ L244), W205 (= W258), Y213 (= Y266), R223 (≠ V276), M228 (= M281), V303 (≠ N347), C304 (= C348), C307 (= C351), H308 (= H352), Y320 (≠ F363), P321 (= P364), L323 (= L366), T327 (≠ A370), T328 (≠ S371), D336 (≠ S379), I341 (≠ V384), V345 (≠ S388), R347 (≠ M390), I354 (≠ L400), M356 (= M402), F359 (= F405), I376 (≠ L417)
- binding ubiquinone-10: M36 (≠ F80), P77 (= P121), S124 (≠ L168), W128 (= W172), C165 (= C209), L173 (≠ D223)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
40% identity, 88% coverage: 46:441/448 of query aligns to 1:386/418 of 7w2jC
- binding heme c: C13 (= C58), C16 (= C61), H17 (= H62), T42 (= T86), I44 (= I88), Y55 (= Y99), L75 (= L119), Y76 (= Y120), A78 (= A122), M79 (= M123), R122 (= R166), H161 (= H205), C162 (= C206), C165 (= C209), H166 (= H210), A191 (= A241), P192 (= P242), R223 (≠ V276), P227 (= P280), M228 (= M281), V289 (≠ N347), C290 (= C348), C293 (= C351), H294 (= H352), Y305 (vs. gap), Y306 (≠ F363), P307 (= P364), L309 (= L366), N312 (= N369), T313 (≠ A370), T314 (≠ S371), D322 (≠ S379), I327 (≠ V384), V331 (≠ S388), R333 (≠ M390), I340 (≠ L400), M342 (= M402), P343 (= P403), F345 (= F405)
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
34% identity, 86% coverage: 41:424/448 of query aligns to 37:410/440 of 8gy3A
- binding heme c: Y52 (≠ D57), C53 (= C58), C56 (= C61), H57 (= H62), S84 (≠ T86), I86 (= I88), W97 (≠ Y99), F102 (= F104), L117 (= L119), F121 (≠ M123), F126 (≠ Y128), R163 (= R166), C203 (= C206), C206 (= C209), H207 (= H210), A232 (= A241), P233 (= P242), L235 (= L244), W245 (= W258), Y253 (= Y266), L254 (= L267), G263 (= G275), S264 (≠ V276), M269 (= M281), Y292 (≠ L304), C337 (= C348), C340 (= C351), H341 (= H352), P353 (= P364), L355 (= L366), N358 (= N369), N359 (≠ A370), V372 (≠ I383), I377 (≠ S388), G382 (≠ A396), Q383 (≠ P397), I386 (≠ L400), M388 (= M402), F391 (= F405)
- binding ubiquinone-10: E55 (≠ A60), T76 (= T78), F78 (= F80), Y118 (= Y120), P119 (= P121), I160 (≠ F163), G166 (≠ M169), Q167 (≠ T170), F169 (≠ W172), W170 (≠ D173), H202 (= H205), R210 (≠ H213), L213 (= L216)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
37% identity, 27% coverage: 322:441/448 of query aligns to 1:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C348), C33 (= C351), H34 (= H352), Y46 (vs. gap), P47 (= P364), T54 (≠ S371), V66 (≠ I383), I67 (≠ V384), R73 (≠ T393), I80 (≠ L400), M82 (= M402), P83 (= P403)
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
32% identity, 23% coverage: 340:441/448 of query aligns to 339:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C348), C350 (= C351), H351 (= H352), F362 (= F363), P363 (= P364), P364 (≠ S365), L365 (= L366), S368 (≠ A370), Y370 (≠ V372), I382 (≠ V384), L386 (≠ S388), S387 (≠ H389), G388 (≠ M390), I390 (vs. gap), V392 (≠ T393), Y397 (≠ T398), N398 (≠ P399), G399 (≠ L400), V400 (≠ A401), M401 (= M402)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
33% identity, 23% coverage: 339:441/448 of query aligns to 354:455/457 of 4ax3D
- binding heme c: C363 (= C348), C366 (= C351), H367 (= H352), P379 (= P364), P380 (≠ S365), L381 (= L366), S384 (≠ A370), F386 (≠ V372), N403 (≠ S388), G404 (≠ H389), S415 (≠ L400), M417 (= M402), M420 (≠ F405)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
33% identity, 23% coverage: 339:441/448 of query aligns to 352:453/456 of 5oboA
- binding heme c: T360 (≠ N347), C361 (= C348), C364 (= C351), H365 (= H352), P377 (= P364), P378 (≠ S365), L379 (= L366), S382 (≠ A370), F384 (≠ V372), I395 (= I383), N401 (≠ S388), G402 (≠ H389), S413 (≠ L400), M415 (= M402), M418 (≠ F405)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
33% identity, 23% coverage: 339:441/448 of query aligns to 351:452/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ N347), C360 (= C348), C363 (= C351), H364 (= H352), P376 (= P364), P377 (≠ S365), L378 (= L366), F383 (≠ V372), N400 (≠ S388), G401 (≠ H389), Y410 (≠ T398), S412 (≠ L400), M414 (= M402), M417 (≠ F405)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
1r0qA Characterization of the conversion of the malformed, recombinant cytochrome rc552 to a 2-formyl-4-vinyl (spirographis) heme (see paper)
31% identity, 25% coverage: 338:448/448 of query aligns to 1:118/130 of 1r0qA
- binding 2-formyl-protoporphryn ix: C13 (= C351), H14 (= H352), P26 (= P364), L28 (= L366), H31 (≠ N369), Y44 (≠ S379), V48 (≠ I383), Q54 (≠ H389), G55 (vs. gap), G66 (≠ L400), M68 (= M402)
Sites not aligning to the query:
1qyzA Characterization of the malformed, recombinant cytochrome rc552 (see paper)
31% identity, 25% coverage: 338:448/448 of query aligns to 1:118/130 of 1qyzA
- binding 2-acetyl-protoporphyrin ix: Y7 (= Y344), C10 (= C348), C13 (= C351), H14 (= H352), P26 (= P364), H31 (≠ N369), Y44 (≠ S379), Q54 (≠ H389), G55 (vs. gap), G66 (≠ L400), M68 (= M402), F71 (= F405)
Sites not aligning to the query:
1dt1A Thermus thermophilus cytochrome c552 synthesized by escherichia coli (see paper)
31% identity, 24% coverage: 340:448/448 of query aligns to 2:117/129 of 1dt1A
- binding heme c: C9 (= C348), C12 (= C351), H13 (= H352), P25 (= P364), H30 (≠ N369), Y43 (≠ S379), V47 (≠ I383), Q53 (≠ H389), G54 (vs. gap), G65 (≠ L400), M67 (= M402), F70 (= F405)
Sites not aligning to the query:
1c52A Thermus thermophilus cytochrome-c552: a new highly thermostable cytochromE-C structure obtained by mad phasing (see paper)
31% identity, 25% coverage: 338:448/448 of query aligns to 2:119/131 of 1c52A
- binding protoporphyrin ix containing fe: C11 (= C348), C14 (= C351), H15 (= H352), F26 (= F363), P27 (= P364), L29 (= L366), H32 (≠ N369), Y45 (≠ S379), L54 (≠ S388), Q55 (≠ H389), G56 (vs. gap), G67 (≠ L400), M69 (= M402), F72 (= F405)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS30785 FitnessBrowser__BFirm:BPHYT_RS30785
MTIQFDRLKQYLIPVFALMCSGALSSGANAQTSNATPTPVSADAQLAKGAYLAKVGDCAA
CHTVNKAQPFAGGLPLATPFGTLYSTNITPDASTGIGGYSYADFATALRQGIAKDGHRLY
PAMPYPSYAKIDDADMHALYRYFMQGVKPIGQPDRASELRFPFNVRALMTVWDRLYAHEQ
LPYQADPHQSVEWNRGAYLVQGLAHCGACHTPHGMLGQESVLDEKDNTAFLSGNTLAGWY
APNLRGHKTQTSDSDNVWSKADLVAYLRSGRMHDGVAFGPMTEVVDDSTQYLHDDDLNAI
ATYLTSPPLQAGATPPAPQQTGRAEQTAIALRAGRVDSSGARLYLDNCAACHRTDGTGAM
PAFPSLRGNASVLSGDPASLIHIVLSGSHMPSTAAAPTPLAMPDFGWRLTDQQVADLLSF
VRTSWGNRAAAVTAGEVAKVRGVALSAK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory