Comparing BPHYT_RS30865 FitnessBrowser__BFirm:BPHYT_RS30865 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
33% identity, 95% coverage: 3:244/256 of query aligns to 2:237/501 of P04983
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
31% identity, 84% coverage: 11:226/256 of query aligns to 8:214/285 of 4yerA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 87% coverage: 5:226/256 of query aligns to 2:228/254 of 1g6hA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 87% coverage: 8:229/256 of query aligns to 3:217/241 of 4u00A
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 87% coverage: 5:226/256 of query aligns to 2:228/253 of 1g9xB
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
32% identity, 84% coverage: 11:226/256 of query aligns to 10:207/353 of 1vciA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
28% identity, 84% coverage: 12:226/256 of query aligns to 11:221/375 of 2d62A
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
33% identity, 84% coverage: 12:226/256 of query aligns to 8:217/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
33% identity, 84% coverage: 12:226/256 of query aligns to 8:217/230 of 6z4wA
A0A0H2ZM82 Cell division ATP-binding protein FtsE from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
33% identity, 84% coverage: 12:226/256 of query aligns to 8:217/230 of A0A0H2ZM82
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
27% identity, 83% coverage: 12:224/256 of query aligns to 6:212/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 83% coverage: 15:226/256 of query aligns to 11:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 83% coverage: 15:226/256 of query aligns to 11:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 83% coverage: 15:226/256 of query aligns to 11:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 83% coverage: 15:226/256 of query aligns to 11:216/242 of 2oljA
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
33% identity, 94% coverage: 15:254/256 of query aligns to 368:605/611 of 8j5qD
Sites not aligning to the query:
1g291 Malk (see paper)
27% identity, 83% coverage: 12:224/256 of query aligns to 8:216/372 of 1g291
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 82% coverage: 19:229/256 of query aligns to 17:222/343 of P30750
Sites not aligning to the query:
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
32% identity, 94% coverage: 15:254/256 of query aligns to 368:605/608 of 8j5tD
Sites not aligning to the query:
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
32% identity, 94% coverage: 15:254/256 of query aligns to 368:605/608 of 8j5sD
Sites not aligning to the query:
>BPHYT_RS30865 FitnessBrowser__BFirm:BPHYT_RS30865
MSDVLEALRGEDIVKRFGAVTALDGVSLTLKQGEILGVLGDNGAGKSTLIKILTGFHQQT
SGKLFVGGEETMLRSVDHARSLGIECVYQDLALANSLSIYHNMFLNREIIRRGPFRLLDN
RAMRERAAECLEEIGVHVPSVDLPVEQLSGGQRQAIAVARAVNSNAKILLLDEPLAAMGA
REAGLIIDLILRLKAKGGLSIVMIMHNYAQTLDIADRVMLMQRGRVTYQREAASTSVEEL
MEIVRREYRAMRAPSH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory