SitesBLAST – Find functional sites

 

SitesBLAST

Comparing BPHYT_RS30865 FitnessBrowser__BFirm:BPHYT_RS30865 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 20 (the maximum) hits to proteins with known functional sites (download)

P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
33% identity, 95% coverage: 3:244/256 of query aligns to 2:237/501 of P04983

query
sites
P04983
D
 
E
V
 
A
L
 
L
E
 
L
A
 
Q
L
 
L
R
 
K
G
 
G
E
 
I
D
 
D
I
 
-
V
 
-
K
 
K
R
 
A
F
 
F
G
 
P
A
 
G
V
 
V
T
 
K
A
 
A
L
 
L
D
 
S
G
 
G
V
 
A
S
 
A
L
 
L
T
 
N
L
 
V
K
 
Y
Q
 
P
G
 
G
E
 
R
I
 
V
L
 
M
G
 
A
V
 
L
L
 
V
G
 
G
D
 
E
N
 
N
G
 
G
A
 
A
G
 
G
K
|
K
S
 
S
T
 
T
L
 
M
I
 
M
K
 
K
I
 
V
L
 
L
T
 
T
G
 
G
F
 
I
H
 
Y
Q
 
T
Q
 
R
T
 
D
S
 
A
G
 
G
K
 
T
L
 
L
F
 
L
V
 
W
G
 
L
G
 
G
E
 
K
E
 
E
T
 
T
M
 
T
L
 
F
R
 
T
S
 
G
V
 
P
D
 
K
H
 
S
A
 
S
R
 
Q
S
 
E
L
 
A
G
 
G
I
 
I
E
 
G
C
 
I
V
 
I
Y
 
H
Q
 
Q
D
 
E
L
 
L
A
 
N
L
 
L
A
 
I
N
 
P
S
 
Q
L
 
L
S
 
T
I
 
I
Y
 
A
H
 
E
N
 
N
M
 
I
F
 
F
L
 
L
N
 
G
R
 
R
E
 
E
I
 
F
I
 
V
R
 
N
R
 
R
G
 
-
P
 
-
F
 
F
R
 
G
L
 
K
L
 
I
D
 
D
N
 
W
R
 
K
A
 
T
M
 
M
R
 
Y
E
 
A
R
 
E
A
 
A
A
 
D
E
 
K
C
 
L
L
 
L
E
 
A
E
 
K
I
 
L
G
 
N
V
 
L
H
 
R
V
 
F
P
 
K
S
 
S
V
 
-
D
 
D
L
 
K
P
 
L
V
 
V
E
 
G
Q
 
D
L
 
L
S
 
S
G
 
I
G
 
G
Q
 
D
R
 
Q
Q
 
Q
A
 
M
I
 
V
A
 
E
V
 
I
A
 
A
R
 
K
A
 
V
V
 
L
N
 
S
S
 
F
N
 
E
A
 
S
K
 
K
I
 
V
L
 
I
L
 
I
L
 
M
D
 
D
E
 
E
P
 
P
L
 
T
A
 
D
A
 
A
M
 
L
G
 
T
A
 
D
R
 
T
E
 
E
A
 
T
G
 
E
L
 
S
I
 
L
I
 
F
D
 
R
L
 
V
I
 
I
L
 
R
R
 
E
L
 
L
K
 
K
A
 
S
K
 
Q
G
 
-
G
 
G
L
 
R
S
 
G
I
 
I
V
 
V
M
 
Y
I
 
I
M
 
S
H
 
H
N
 
R
Y
 
M
A
 
K
Q
 
E
T
 
I
L
 
F
D
 
E
I
 
I
A
 
C
D
 
D
R
 
D
V
 
V
M
 
T
L
 
V
M
 
F
Q
 
R
R
 
D
G
 
G
R
 
Q
V
 
F
T
 
I
Y
 
A
Q
 
E
R
 
R
E
 
E
A
 
V
A
 
A
S
 
S
T
 
L
S
 
T
V
 
E
E
 
D
E
 
S
L
 
L
M
 
I
E
 
E
I
 
M
V
 
M

4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
31% identity, 84% coverage: 11:226/256 of query aligns to 8:214/285 of 4yerA

query
sites
4yerA
E
 
E
D
 
N
I
 
L
V
 
V
K
 
K
R
 
K
F
|
F
G
 
G
A
 
D
V
x
F
T
 
E
A
 
A
L
 
V
D
 
K
G
 
G
V
 
V
S
 
S
L
 
F
T
 
S
L
 
V
K
 
K
Q
 
K
G
 
G
E
 
E
I
 
I
L
 
F
G
 
A
V
 
F
L
 
L
G
 
G
D
 
P
N
|
N
G
|
G
A
 
A
G
|
G
K
|
K
S
x
T
T
|
T
L
 
T
I
 
I
K
 
H
I
 
M
L
 
L
T
 
T
G
 
T
F
 
L
H
 
L
Q
 
K
Q
 
P
T
 
T
S
 
S
G
 
G
K
 
K
L
 
A
F
 
W
V
 
V
G
 
A
G
 
G
E
 
H
E
 
D
T
 
V
M
 
L
L
 
K
R
 
E
S
 
P
V
 
R
D
 
E
H
 
V
A
 
R
R
 
R
S
 
K
L
 
I
G
 
G
I
 
I
E
 
-
C
 
-
V
 
V
Y
 
F
Q
 
Q
D
 
D
L
 
Q
A
 
S
L
 
L
A
 
D
N
 
R
S
 
E
L
 
L
S
 
T
I
 
A
Y
 
Y
H
 
E
N
 
N
M
 
M
F
 
Y
L
 
I
N
 
H
R
 
G
E
 
K
I
 
I
I
 
Y
R
 
G
R
 
Y
G
 
G
P
 
G
F
 
E
R
 
K
L
 
L
L
 
-
D
 
-
N
 
-
R
 
-
A
 
-
M
 
-
R
 
-
E
 
K
R
 
K
A
 
R
A
 
I
E
 
L
C
 
E
L
 
L
E
 
L
E
 
E
I
 
F
G
 
V
V
 
E
H
 
L
V
 
L
P
 
E
S
 
F
V
 
K
D
 
D
L
 
K
P
 
P
V
 
V
E
 
K
Q
x
T
L
x
F
S
|
S
G
 
G
G
 
G
Q
 
M
R
 
A
Q
 
R
A
 
R
I
 
L
A
 
E
V
 
I
A
 
A
R
 
R
A
 
S
V
 
L
N
 
I
S
 
H
N
 
E
A
 
P
K
 
E
I
 
V
L
 
L
L
 
F
L
 
L
D
 
D
E
 
E
P
 
P
L
 
T
A
 
I
A
 
G
M
 
L
G
 
D
A
 
P
R
 
H
E
 
T
A
 
R
G
 
A
L
 
H
I
 
M
I
 
W
D
 
E
L
 
Y
I
 
I
L
 
S
R
 
K
L
 
M
K
 
K
A
 
K
K
 
E
G
 
H
G
 
N
L
 
M
S
 
T
I
 
I
V
 
F
M
 
L
I
 
T
M
 
T
H
 
H
N
 
Y
Y
 
M
A
 
D
Q
 
E
T
 
A
L
 
E
D
 
Q
I
 
L
A
 
A
D
 
D
R
 
R
V
 
V
M
 
A
L
 
I
M
 
I
Q
 
D
R
 
H
G
 
G
R
 
K
V
 
I

1g6hA Crystal structure of the adp conformation of mj1267, an atp- binding cassette of an abc transporter (see paper)
30% identity, 87% coverage: 5:226/256 of query aligns to 2:228/254 of 1g6hA

query
sites
1g6hA
L
 
M
E
 
E
A
 
I
L
 
L
R
 
R
G
 
T
E
 
E
D
 
N
I
 
I
V
 
V
K
 
K
R
 
Y
F
|
F
G
 
G
A
 
E
V
x
F
T
 
K
A
 
A
L
 
L
D
 
D
G
 
G
V
 
V
S
 
S
L
 
I
T
 
S
L
 
V
K
 
N
Q
 
K
G
 
G
E
 
D
I
 
V
L
 
T
G
 
L
V
 
I
L
 
I
G
 
G
D
 
P
N
|
N
G
|
G
A
 
S
G
|
G
K
|
K
S
|
S
T
|
T
L
 
L
I
 
I
K
 
N
I
 
V
L
 
I
T
 
T
G
 
G
F
 
F
H
 
L
Q
 
K
Q
 
A
T
 
D
S
 
E
G
 
G
K
 
R
L
 
V
F
 
Y
V
 
F
G
 
E
G
 
N
E
 
K
E
 
D
T
 
I
M
 
T
L
 
N
R
 
K
S
 
E
V
 
P
D
 
A
H
 
E
A
 
L
R
 
Y
S
 
H
L
 
Y
G
 
G
I
 
I
E
 
V
C
 
R
V
 
T
Y
 
F
Q
 
Q
D
 
T
L
 
P
A
 
Q
L
 
P
A
 
L
N
 
K
S
 
E
L
 
M
S
 
T
I
 
V
Y
 
L
H
 
E
N
 
N
M
 
L
F
 
L
L
 
I
N
 
G
R
 
E
E
 
I
I
 
C
I
 
P
R
 
G
R
 
E
G
 
S
P
 
P
F
 
L
R
 
N
L
 
S
L
 
L
-
 
F
-
 
Y
-
 
K
-
 
K
-
 
W
-
 
I
-
 
P
D
 
K
N
 
E
R
 
E
A
 
E
M
 
M
R
 
V
E
 
E
R
 
K
A
 
A
A
 
F
E
 
K
C
 
I
L
 
L
E
 
E
E
 
F
I
 
L
G
 
K
V
 
L
-
 
S
H
 
H
V
 
L
P
 
-
S
 
-
V
 
Y
D
 
D
L
 
R
P
 
K
V
 
A
E
 
G
Q
 
E
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
M
Q
 
K
A
 
L
I
 
V
A
 
E
V
 
I
A
 
G
R
 
R
A
 
A
V
 
L
N
 
M
S
 
T
N
 
N
A
 
P
K
 
K
I
 
M
L
 
I
L
 
V
L
 
M
D
 
D
E
 
E
P
 
P
L
 
I
A
 
A
A
 
G
M
 
V
G
 
A
A
 
P
R
 
G
E
 
L
A
 
A
G
 
H
L
 
D
I
 
I
I
 
F
D
 
N
L
 
H
I
 
V
L
 
L
R
 
E
L
 
L
K
 
K
A
 
A
K
 
K
G
 
-
G
 
G
L
 
I
S
 
T
I
 
F
V
 
L
M
 
I
I
 
I
M
 
E
H
 
H
N
 
R
Y
 
L
A
 
D
Q
 
I
T
 
V
L
 
L
D
 
N
I
 
Y
A
 
I
D
 
D
R
 
H
V
 
L
M
 
Y
L
 
V
M
 
M
Q
 
F
R
 
N
G
 
G
R
 
Q
V
 
I

4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 87% coverage: 8:229/256 of query aligns to 3:217/241 of 4u00A

query
sites
4u00A
L
 
I
R
 
R
G
 
I
E
 
R
D
 
N
I
 
L
V
 
H
K
 
K
R
 
W
F
|
F
G
 
G
A
 
P
V
 
L
T
 
H
A
x
V
L
 
L
D
 
K
G
 
G
V
 
I
S
 
H
L
 
L
T
 
E
L
 
V
K
 
A
Q
 
P
G
 
G
E
 
E
I
 
K
L
 
L
G
 
V
V
 
I
L
 
I
G
 
G
D
 
P
N
x
S
G
|
G
A
x
S
G
|
G
K
|
K
S
|
S
T
|
T
L
 
L
I
 
I
K
 
R
I
 
T
L
 
I
T
 
N
G
 
R
F
 
L
H
 
E
Q
 
D
Q
 
F
T
 
Q
S
 
E
G
 
G
K
 
E
L
 
V
F
 
V
V
 
V
G
 
D
G
 
G
-
 
L
-
 
S
-
 
V
-
 
K
E
 
D
E
 
D
T
 
R
M
 
A
L
 
L
R
 
R
S
 
E
V
 
I
D
 
-
H
 
-
A
 
R
R
 
R
S
 
E
L
 
V
G
 
G
I
 
M
E
 
-
C
 
-
V
 
V
Y
 
F
Q
 
Q
D
 
Q
L
 
F
A
 
N
L
 
L
A
 
F
N
 
P
S
 
H
L
 
M
S
 
T
I
 
V
Y
 
L
H
 
E
N
 
N
M
 
V
F
 
T
L
 
L
N
 
A
R
 
P
E
 
M
I
 
R
I
 
V
R
 
R
R
 
R
G
 
W
P
 
P
F
 
R
R
 
E
L
 
K
L
 
A
D
 
E
N
 
K
R
 
K
A
 
A
M
 
L
R
 
-
E
 
-
R
 
-
A
 
-
A
 
-
E
 
E
C
 
L
L
 
L
E
 
E
E
 
R
I
 
V
G
 
G
V
 
I
H
 
L
V
 
D
P
 
Q
S
 
A
V
 
R
D
 
K
L
 
Y
P
 
P
V
 
A
E
 
-
Q
 
Q
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
Q
Q
 
Q
A
 
R
I
 
V
A
 
A
V
 
I
A
 
A
R
 
R
A
 
A
V
 
L
N
 
A
S
 
M
N
 
E
A
 
P
K
 
K
I
 
I
L
 
M
L
 
L
L
 
F
D
 
D
E
 
E
P
 
P
L
 
T
A
 
S
A
 
A
M
 
L
G
 
D
A
 
P
R
 
E
E
 
M
A
 
V
G
 
G
L
 
E
I
 
V
I
 
L
D
 
D
L
 
-
I
 
V
L
 
M
R
 
R
L
 
D
K
 
L
A
 
A
K
 
Q
G
 
G
G
 
G
L
 
M
S
 
T
I
 
M
V
 
V
M
 
V
I
 
V
M
 
T
H
 
H
N
 
E
Y
 
M
A
 
G
Q
 
F
T
 
A
L
 
R
D
 
E
I
 
V
A
 
A
D
 
D
R
 
R
V
 
V
M
 
V
L
 
F
M
 
M
Q
 
D
R
 
G
G
 
G
R
 
Q
V
 
I
T
 
V
Y
 
E
Q
 
E

1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 87% coverage: 5:226/256 of query aligns to 2:228/253 of 1g9xB

query
sites
1g9xB
L
 
M
E
 
E
A
 
I
L
 
L
R
 
R
G
 
T
E
 
E
D
 
N
I
 
I
V
 
V
K
 
K
R
 
Y
F
|
F
G
 
G
A
 
E
V
x
F
T
 
K
A
 
A
L
 
L
D
 
D
G
 
G
V
 
V
S
 
S
L
 
I
T
 
S
L
 
V
K
 
C
Q
 
K
G
 
G
E
 
D
I
 
V
L
 
T
G
 
L
V
 
I
L
 
I
G
 
G
D
 
P
N
 
N
G
|
G
A
x
S
G
|
G
K
|
K
S
|
S
T
|
T
L
 
L
I
 
I
K
 
N
I
 
V
L
 
I
T
 
T
G
 
G
F
 
F
H
 
L
Q
 
K
Q
 
A
T
 
D
S
 
E
G
 
G
K
 
R
L
 
V
F
 
Y
V
 
F
G
 
E
G
 
N
E
 
K
E
 
D
T
 
I
M
 
T
L
 
N
R
 
K
S
 
E
V
 
P
D
 
A
H
 
E
A
 
L
R
 
Y
S
 
H
L
 
Y
G
 
G
I
 
I
E
 
V
C
 
R
V
 
T
Y
 
F
Q
 
Q
D
 
T
L
 
P
A
 
Q
L
 
P
A
 
L
N
 
K
S
 
E
L
 
M
S
 
T
I
 
V
Y
 
L
H
 
E
N
 
N
M
 
L
F
 
L
L
 
I
N
 
G
R
 
E
E
 
I
I
 
N
I
 
P
R
 
G
R
 
E
G
 
S
P
 
P
F
 
L
R
 
N
L
 
S
L
 
L
-
 
F
-
 
Y
-
 
K
-
 
K
-
 
W
-
 
I
-
 
P
D
 
K
N
 
E
R
 
E
A
 
E
M
 
M
R
 
V
E
 
E
R
 
K
A
 
A
A
 
F
E
 
K
C
 
I
L
 
L
E
 
E
E
 
F
I
 
L
G
 
K
V
 
L
-
 
S
H
 
H
V
 
L
P
 
-
S
 
-
V
 
Y
D
 
D
L
 
R
P
 
K
V
 
A
E
 
G
Q
 
E
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
M
Q
 
K
A
 
L
I
 
V
A
 
E
V
 
I
A
 
G
R
 
R
A
 
A
V
 
L
N
 
M
S
 
T
N
 
N
A
 
P
K
 
K
I
 
M
L
 
I
L
 
V
L
 
M
D
 
D
E
|
E
P
 
P
L
 
I
A
 
A
A
 
G
M
 
V
G
 
A
A
 
P
R
 
G
E
 
L
A
 
A
G
 
H
L
 
D
I
 
I
I
 
F
D
 
N
L
 
H
I
 
V
L
 
L
R
 
E
L
 
L
K
 
K
A
 
A
K
 
K
G
 
-
G
 
G
L
 
I
S
 
T
I
 
F
V
 
L
M
 
I
I
 
I
M
 
E
H
 
H
N
 
R
Y
 
L
A
 
D
Q
 
I
T
 
V
L
 
L
D
 
N
I
 
Y
A
 
I
D
 
D
R
 
H
V
 
L
M
 
Y
L
 
V
M
 
M
Q
 
F
R
 
N
G
 
G
R
 
Q
V
 
I

1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
32% identity, 84% coverage: 11:226/256 of query aligns to 10:207/353 of 1vciA

query
sites
1vciA
E
 
E
D
 
N
I
 
L
V
 
T
K
 
K
R
 
R
F
|
F
G
 
G
A
 
N
V
x
F
T
 
T
A
 
A
L
 
V
D
 
N
G
 
K
V
 
L
S
 
N
L
 
L
T
 
T
L
 
I
K
 
K
Q
 
D
G
 
G
E
 
E
I
 
F
L
 
L
G
 
V
V
 
L
L
 
L
G
 
G
D
 
P
N
x
S
G
|
G
A
 
C
G
|
G
K
|
K
S
x
T
T
|
T
L
 
T
I
 
L
K
 
R
I
 
M
L
 
I
T
 
A
G
 
G
F
 
L
H
 
E
Q
 
E
Q
 
P
T
 
T
S
 
E
G
 
G
K
 
R
L
 
I
F
 
Y
V
 
F
G
 
G
G
 
D
E
 
R
E
 
D
-
 
V
T
 
T
M
 
Y
L
 
L
R
 
P
S
 
P
V
 
K
D
 
D
H
 
R
A
 
-
R
 
-
S
 
-
L
 
-
G
 
N
I
 
I
E
 
S
C
 
M
V
 
V
Y
 
F
Q
 
Q
D
 
-
L
 
-
A
 
-
L
 
-
A
 
-
N
 
-
S
 
H
L
 
M
S
 
T
I
 
V
Y
 
Y
H
 
E
N
 
N
M
 
I
F
 
A
L
 
F
N
 
P
R
 
-
E
 
-
I
 
-
I
 
L
R
 
K
R
 
K
G
 
F
P
 
P
F
 
K
R
 
D
L
 
E
L
 
I
D
 
D
N
 
K
R
 
R
A
 
V
M
 
-
R
 
-
E
 
R
R
 
W
A
 
A
A
 
A
E
 
E
C
 
L
L
 
L
-
 
Q
-
 
I
E
 
E
E
 
E
I
 
L
G
 
L
V
 
N
H
 
R
V
 
Y
P
 
P
S
 
A
V
 
-
D
 
-
L
 
-
P
 
-
V
 
-
E
 
-
Q
 
Q
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
R
Q
 
Q
A
 
R
I
 
V
A
 
A
V
 
V
A
 
A
R
 
R
A
 
A
V
 
I
N
 
V
S
 
V
N
 
E
A
 
P
K
 
D
I
 
V
L
 
L
L
 
L
L
 
M
D
 
D
E
 
E
P
 
P
L
 
L
A
 
S
A
 
N
M
 
L
G
 
D
A
 
A
R
 
K
E
 
L
A
 
R
G
 
V
L
 
A
I
 
M
I
 
R
D
 
A
L
 
E
I
 
I
L
 
K
R
 
K
L
 
L
K
 
Q
A
 
Q
K
 
K
G
 
L
G
 
K
L
 
V
S
 
T
I
 
T
V
 
I
M
 
Y
I
 
V
M
 
T
H
 
H
N
 
D
Y
 
Q
A
 
V
Q
 
E
T
 
A
L
 
M
D
 
T
I
 
M
A
 
G
D
 
D
R
 
R
V
 
I
M
 
A
L
 
V
M
 
M
Q
 
N
R
 
R
G
 
G
R
 
Q
V
 
L

2d62A Crystal structure of multiple sugar binding transport atp- binding protein
28% identity, 84% coverage: 12:226/256 of query aligns to 11:221/375 of 2d62A

query
sites
2d62A
D
 
N
I
 
I
V
 
W
K
 
K
R
 
R
F
 
F
G
 
G
A
 
D
V
 
V
T
 
T
A
 
A
L
 
V
D
 
K
G
 
D
V
 
L
S
 
S
L
 
L
T
 
E
L
 
I
K
 
K
Q
 
D
G
 
G
E
 
E
I
 
F
L
 
L
G
 
V
V
 
L
L
 
L
G
 
G
D
 
P
N
 
S
G
|
G
A
x
C
G
|
G
K
|
K
S
x
T
T
|
T
L
 
T
I
 
L
K
 
R
I
 
M
L
 
I
T
 
A
G
 
G
F
 
L
H
 
E
Q
 
E
Q
 
P
T
 
T
S
 
R
G
 
G
K
 
Q
L
 
I
F
 
Y
V
 
I
G
 
-
G
 
-
E
 
E
E
 
D
T
 
N
M
 
L
L
 
V
R
 
A
S
 
D
V
 
P
D
 
E
H
 
K
-
 
G
-
 
V
-
 
F
-
 
V
-
 
P
A
 
P
R
 
K
S
 
E
L
 
R
G
 
D
I
 
V
E
 
A
C
 
M
V
 
V
Y
 
F
Q
 
Q
D
 
S
L
 
Y
A
 
A
L
 
L
A
 
Y
N
 
P
S
 
H
L
 
M
S
 
T
I
 
V
Y
 
Y
H
 
D
N
 
N
M
 
I
F
 
A
L
 
F
N
 
P
R
 
L
E
 
K
I
 
-
I
 
L
R
 
R
R
 
K
G
 
V
P
 
P
F
 
K
R
 
Q
L
 
E
L
 
I
D
 
D
N
 
K
R
 
R
A
 
V
M
 
R
R
 
E
E
 
V
R
 
A
A
 
E
A
 
M
E
 
L
C
 
G
L
 
L
E
 
T
E
 
E
I
 
L
G
 
L
V
 
N
H
 
R
V
 
K
P
 
P
S
 
R
V
 
-
D
 
-
L
 
-
P
 
-
V
 
-
E
 
-
Q
 
E
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
R
Q
 
Q
A
 
R
I
 
V
A
 
A
V
 
L
A
 
G
R
 
R
A
 
A
V
 
I
N
 
I
S
 
R
N
 
R
A
 
P
K
 
K
I
 
V
L
 
F
L
 
L
L
 
M
D
 
D
E
 
E
P
 
P
L
 
L
A
 
S
A
 
N
M
 
L
G
 
D
A
 
A
R
 
K
E
 
L
A
 
R
G
 
V
L
 
K
I
 
M
I
 
R
D
 
A
L
 
E
I
 
L
L
 
K
R
 
K
L
 
L
K
 
Q
A
 
R
K
 
Q
G
 
L
G
 
G
L
 
V
S
 
T
I
 
T
V
 
I
M
 
Y
I
 
V
M
 
T
H
 
H
N
 
D
Y
 
Q
A
 
V
Q
 
E
T
 
A
L
 
M
D
 
T
I
 
M
A
 
G
D
 
D
R
 
R
V
 
I
M
 
A
L
 
V
M
 
M
Q
 
N
R
 
K
G
 
G
R
 
E
V
 
L

6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
33% identity, 84% coverage: 12:226/256 of query aligns to 8:217/229 of 6z67B

query
sites
6z67B
D
 
D
I
 
V
V
 
V
K
 
K
R
 
K
F
x
Y
-
 
D
G
 
N
A
x
G
V
 
T
T
 
T
A
|
A
L
 
L
D
 
R
G
 
G
V
 
V
S
 
S
L
 
V
T
 
S
L
 
V
K
 
Q
Q
 
P
G
 
G
E
 
E
I
 
F
L
 
A
G
 
Y
V
 
I
L
 
V
G
 
G
D
 
P
N
x
S
G
|
G
A
 
A
G
|
G
K
|
K
S
|
S
T
|
T
L
 
F
I
 
I
K
 
R
I
 
S
L
 
L
T
 
Y
G
 
R
F
 
E
H
 
V
Q
 
K
Q
 
I
T
 
D
S
 
K
G
 
G
K
 
S
L
 
L
F
 
S
V
 
V
G
 
A
G
 
G
E
 
F
E
 
N
T
 
L
M
 
V
-
 
K
L
 
I
R
 
K
S
 
K
V
 
K
D
 
D
H
 
V
A
 
P
-
 
L
-
 
L
-
 
R
R
 
R
S
 
S
L
 
V
G
 
G
I
 
V
E
 
-
C
 
-
V
 
V
Y
 
F
Q
 
Q
D
 
D
L
 
Y
A
 
K
L
 
L
A
 
L
N
 
P
S
 
K
L
 
K
S
 
T
I
 
V
Y
 
Y
H
 
E
N
 
N
M
 
I
F
 
A
L
 
Y
N
 
A
R
 
M
E
 
E
I
 
V
I
 
I
R
 
G
R
 
E
G
 
-
P
 
-
F
 
-
R
 
-
L
 
-
L
 
-
D
 
N
N
 
R
R
 
R
A
 
N
M
 
I
R
 
K
E
 
R
R
 
R
A
 
V
A
 
M
E
 
E
C
 
V
L
 
L
E
 
D
E
 
L
I
 
V
G
 
G
V
 
L
H
 
K
V
 
H
P
 
K
S
 
V
V
 
R
D
 
S
L
 
F
P
 
P
V
 
N
E
 
E
Q
 
-
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
E
R
 
Q
Q
 
Q
A
 
R
I
 
I
A
 
A
V
 
I
A
 
A
R
 
R
A
 
A
V
 
I
N
 
V
S
 
N
N
 
N
A
 
P
K
 
K
I
 
V
L
 
L
L
 
I
L
 
A
D
 
D
E
 
E
P
 
P
L
 
T
A
 
G
A
 
N
M
 
L
G
 
D
A
 
P
R
 
D
E
 
N
A
 
S
G
 
W
L
 
E
I
 
I
I
 
M
D
 
N
L
 
L
I
 
L
L
 
E
R
 
R
L
 
I
K
 
N
A
 
L
K
 
Q
G
 
-
G
 
G
L
 
T
S
 
T
I
 
I
V
 
L
M
 
M
I
 
A
M
 
T
H
 
H
N
 
N
Y
 
S
A
 
Q
Q
 
I
T
 
V
L
 
N
D
 
T
I
 
L
A
 
R
D
 
H
R
 
R
V
 
V
M
 
I
L
 
A
M
 
I
Q
 
E
R
 
N
G
 
G
R
 
R
V
 
V

6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
33% identity, 84% coverage: 12:226/256 of query aligns to 8:217/230 of 6z4wA

query
sites
6z4wA
D
 
D
I
 
V
V
 
V
K
 
K
R
 
K
F
x
Y
-
 
D
G
 
N
A
 
G
V
x
T
T
 
T
A
|
A
L
 
L
D
 
R
G
 
G
V
 
V
S
 
S
L
 
V
T
 
S
L
 
V
K
 
Q
Q
 
P
G
 
G
E
 
E
I
 
F
L
 
A
G
 
Y
V
 
I
L
 
V
G
 
G
D
 
P
N
 
S
G
|
G
A
 
A
G
|
G
K
|
K
S
|
S
T
|
T
L
 
F
I
 
I
K
 
R
I
 
S
L
 
L
T
 
Y
G
 
R
F
 
E
H
 
V
Q
 
K
Q
 
I
T
 
D
S
 
K
G
 
G
K
 
S
L
 
L
F
 
S
V
 
V
G
 
A
G
 
G
E
 
F
E
 
N
T
 
L
M
 
V
-
 
K
L
 
I
R
 
K
S
 
K
V
 
K
D
 
D
H
 
V
A
 
P
-
 
L
-
 
L
-
 
R
R
 
R
S
 
S
L
 
V
G
 
G
I
 
V
E
 
-
C
 
-
V
 
V
Y
 
F
Q
 
Q
D
 
D
L
 
Y
A
 
K
L
 
L
A
 
L
N
 
P
S
 
K
L
 
K
S
 
T
I
 
V
Y
 
Y
H
 
E
N
 
N
M
 
I
F
 
A
L
 
Y
N
 
A
R
 
M
E
 
E
I
 
V
I
 
I
R
 
G
R
 
E
G
 
-
P
 
-
F
 
-
R
 
-
L
 
-
L
 
-
D
 
N
N
 
R
R
 
R
A
 
N
M
 
I
R
 
K
E
 
R
R
 
R
A
 
V
A
 
M
E
 
E
C
 
V
L
 
L
E
 
D
E
 
L
I
 
V
G
 
G
V
 
L
H
 
K
V
 
H
P
 
K
S
 
V
V
 
R
D
 
S
L
 
F
P
 
P
V
 
N
E
 
E
Q
 
-
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
E
R
 
Q
Q
 
Q
A
 
R
I
 
I
A
 
A
V
 
I
A
 
A
R
 
R
A
 
A
V
 
I
N
 
V
S
 
N
N
 
N
A
 
P
K
 
K
I
 
V
L
 
L
L
 
I
L
 
A
D
 
D
E
 
E
P
 
P
L
 
T
A
 
G
A
 
N
M
 
L
G
 
D
A
 
P
R
 
D
E
 
N
A
 
S
G
 
W
L
 
E
I
 
I
I
 
M
D
 
N
L
 
L
I
 
L
L
 
E
R
 
R
L
 
I
K
 
N
A
 
L
K
 
Q
G
 
-
G
 
G
L
 
T
S
 
T
I
 
I
V
 
L
M
 
M
I
 
A
M
 
T
H
 
H
N
 
N
Y
 
S
A
 
Q
Q
 
I
T
 
V
L
 
N
D
 
T
I
 
L
A
 
R
D
 
H
R
 
R
V
 
V
M
 
I
L
 
A
M
 
I
Q
 
E
R
 
N
G
 
G
R
 
R
V
 
V

1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
29% identity, 82% coverage: 18:227/256 of query aligns to 16:220/353 of 1oxvD

query
sites
1oxvD
G
 
G
A
 
K
V
 
V
T
 
V
A
 
A
L
 
L
D
 
D
G
 
N
V
 
V
S
 
N
L
 
I
T
 
N
L
 
I
K
 
E
Q
 
N
G
 
G
E
 
E
I
 
R
L
 
F
G
 
G
V
 
I
L
 
L
G
 
G
D
 
P
N
x
S
G
|
G
A
 
A
G
|
G
K
|
K
S
x
T
T
|
T
L
 
F
I
 
M
K
 
R
I
 
I
L
 
I
T
 
A
G
 
G
F
 
L
H
 
D
Q
 
V
Q
 
P
T
 
S
S
 
T
G
 
G
K
 
E
L
 
L
F
 
Y
V
 
F
G
 
D
-
 
D
-
 
R
-
 
L
-
 
V
G
 
A
E
 
S
E
 
N
T
 
G
M
 
K
L
 
L
R
 
I
S
 
V
V
 
P
D
 
P
H
 
E
A
 
D
R
 
R
S
 
K
L
 
I
G
 
G
I
 
M
E
 
-
C
 
-
V
 
V
Y
 
F
Q
|
Q
D
 
T
L
 
W
A
 
A
L
 
L
A
 
Y
N
 
P
S
 
N
L
 
L
S
 
T
I
 
A
Y
 
F
H
 
E
N
 
N
M
 
I
F
 
A
L
 
F
N
 
P
R
 
L
E
 
T
I
 
N
I
 
M
R
 
K
R
 
-
G
 
-
P
 
-
F
 
-
R
 
-
L
 
-
L
 
M
D
 
S
N
 
K
R
 
E
A
 
E
M
 
I
R
 
R
E
 
K
R
 
R
A
 
V
A
 
E
E
 
E
C
 
V
L
 
A
E
 
K
E
 
I
I
 
L
G
 
D
V
 
I
H
 
H
V
 
H
P
 
V
S
 
L
V
 
N
D
 
H
L
 
F
P
 
P
V
 
R
E
 
E
Q
 
-
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
Q
Q
 
Q
A
 
R
I
 
V
A
 
A
V
 
L
A
 
A
R
 
R
A
 
A
V
 
L
N
 
V
S
 
K
N
 
D
A
 
P
K
 
S
I
 
L
L
 
L
L
 
L
L
 
L
D
 
D
E
|
E
P
 
P
L
 
F
A
 
S
A
 
N
M
 
L
G
 
D
A
 
A
R
 
R
E
 
M
A
 
R
G
 
D
L
 
S
I
 
A
I
 
R
D
 
A
L
 
L
I
 
V
L
 
K
R
 
E
L
 
V
K
 
Q
A
 
S
K
 
R
G
 
L
G
 
G
L
 
V
S
 
T
I
 
L
V
 
L
M
 
V
I
 
V
M
 
S
H
 
H
N
 
D
Y
 
P
A
 
A
Q
 
D
T
 
I
L
 
F
D
 
A
I
 
I
A
 
A
D
 
D
R
 
R
V
 
V
M
 
G
L
 
V
M
 
L
Q
 
V
R
 
K
G
 
G
R
 
K
V
 
L
T
 
V

Sites not aligning to the query:

1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
29% identity, 82% coverage: 18:227/256 of query aligns to 16:220/353 of 1oxvA

query
sites
1oxvA
G
 
G
A
 
K
V
 
V
T
 
V
A
 
A
L
 
L
D
 
D
G
 
N
V
 
V
S
 
N
L
 
I
T
 
N
L
 
I
K
 
E
Q
 
N
G
 
G
E
 
E
I
 
R
L
 
F
G
 
G
V
 
I
L
 
L
G
 
G
D
 
P
N
x
S
G
|
G
A
 
A
G
|
G
K
|
K
S
x
T
T
|
T
L
 
F
I
 
M
K
 
R
I
 
I
L
 
I
T
 
A
G
 
G
F
 
L
H
 
D
Q
 
V
Q
 
P
T
 
S
S
 
T
G
 
G
K
 
E
L
 
L
F
 
Y
V
 
F
G
 
D
-
 
D
-
 
R
-
 
L
-
 
V
G
 
A
E
 
S
E
 
N
T
 
G
M
 
K
L
 
L
R
 
I
S
 
V
V
 
P
D
 
P
H
 
E
A
 
D
R
 
R
S
 
K
L
 
I
G
 
G
I
 
M
E
 
-
C
 
-
V
 
V
Y
 
F
Q
 
Q
D
 
T
L
 
W
A
 
A
L
 
L
A
 
Y
N
 
P
S
 
N
L
 
L
S
 
T
I
 
A
Y
 
F
H
 
E
N
 
N
M
 
I
F
 
A
L
 
F
N
 
P
R
 
L
E
 
T
I
 
N
I
 
M
R
 
K
R
 
-
G
 
-
P
 
-
F
 
-
R
 
-
L
 
-
L
 
M
D
 
S
N
 
K
R
 
E
A
 
E
M
 
I
R
 
R
E
 
K
R
 
R
A
 
V
A
 
E
E
 
E
C
 
V
L
 
A
E
 
K
E
 
I
I
 
L
G
 
D
V
 
I
H
 
H
V
 
H
P
 
V
S
 
L
V
 
N
D
 
H
L
 
F
P
 
P
V
 
R
E
 
E
Q
 
-
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
Q
Q
 
Q
A
 
R
I
 
V
A
 
A
V
 
L
A
 
A
R
 
R
A
 
A
V
 
L
N
 
V
S
 
K
N
 
D
A
 
P
K
 
S
I
 
L
L
 
L
L
 
L
L
 
L
D
 
D
E
|
E
P
 
P
L
 
F
A
 
S
A
 
N
M
 
L
G
 
D
A
 
A
R
 
R
E
 
M
A
 
R
G
 
D
L
 
S
I
 
A
I
 
R
D
 
A
L
 
L
I
 
V
L
 
K
R
 
E
L
 
V
K
 
Q
A
 
S
K
 
R
G
 
L
G
 
G
L
 
V
S
 
T
I
 
L
V
 
L
M
 
V
I
 
V
M
 
S
H
 
H
N
 
D
Y
 
P
A
 
A
Q
 
D
T
 
I
L
 
F
D
 
A
I
 
I
A
 
A
D
 
D
R
 
R
V
 
V
M
 
G
L
 
V
M
 
L
Q
 
V
R
 
K
G
 
G
R
 
K
V
 
L
T
 
V

Sites not aligning to the query:

1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
29% identity, 82% coverage: 18:227/256 of query aligns to 16:220/353 of 1oxuA

query
sites
1oxuA
G
 
G
A
 
K
V
 
V
T
 
V
A
|
A
L
 
L
D
 
D
G
 
N
V
 
V
S
 
N
L
 
I
T
 
N
L
 
I
K
 
E
Q
 
N
G
 
G
E
 
E
I
 
R
L
 
F
G
 
G
V
 
I
L
 
L
G
 
G
D
 
P
N
 
S
G
|
G
A
 
A
G
|
G
K
|
K
S
x
T
T
|
T
L
 
F
I
 
M
K
 
R
I
 
I
L
 
I
T
 
A
G
 
G
F
 
L
H
 
D
Q
 
V
Q
 
P
T
 
S
S
 
T
G
 
G
K
 
E
L
 
L
F
 
Y
V
 
F
G
 
D
-
 
D
-
 
R
-
 
L
-
 
V
G
 
A
E
 
S
E
 
N
T
 
G
M
 
K
L
 
L
R
 
I
S
 
V
V
 
P
D
 
P
H
 
E
A
 
D
R
 
R
S
 
K
L
 
I
G
 
G
I
 
M
E
 
-
C
 
-
V
 
V
Y
 
F
Q
 
Q
D
 
T
L
 
W
A
 
A
L
 
L
A
 
Y
N
 
P
S
 
N
L
 
L
S
 
T
I
 
A
Y
 
F
H
 
E
N
 
N
M
 
I
F
 
A
L
 
F
N
 
P
R
 
L
E
 
T
I
 
N
I
 
M
R
 
K
R
 
-
G
 
-
P
 
-
F
 
-
R
 
-
L
 
-
L
 
M
D
 
S
N
 
K
R
 
E
A
 
E
M
 
I
R
 
R
E
 
K
R
 
R
A
 
V
A
 
E
E
 
E
C
 
V
L
 
A
E
 
K
E
 
I
I
 
L
G
 
D
V
 
I
H
 
H
V
 
H
P
 
V
S
 
L
V
 
N
D
 
H
L
 
F
P
 
P
V
 
R
E
 
E
Q
 
-
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
Q
Q
 
Q
A
 
R
I
 
V
A
 
A
V
 
L
A
 
A
R
 
R
A
 
A
V
 
L
N
 
V
S
 
K
N
 
D
A
 
P
K
 
S
I
 
L
L
 
L
L
 
L
L
 
L
D
 
D
E
 
E
P
 
P
L
 
F
A
 
S
A
 
N
M
 
L
G
 
D
A
 
A
R
 
R
E
 
M
A
 
R
G
 
D
L
 
S
I
 
A
I
 
R
D
 
A
L
 
L
I
 
V
L
 
K
R
 
E
L
 
V
K
 
Q
A
 
S
K
 
R
G
 
L
G
 
G
L
 
V
S
 
T
I
 
L
V
 
L
M
 
V
I
 
V
M
 
S
H
 
H
N
 
D
Y
 
P
A
 
A
Q
 
D
T
 
I
L
 
F
D
 
A
I
 
I
A
 
A
D
 
D
R
 
R
V
 
V
M
 
G
L
 
V
M
 
L
Q
 
V
R
 
K
G
 
G
R
 
K
V
 
L
T
 
V

Sites not aligning to the query:

4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
27% identity, 83% coverage: 12:224/256 of query aligns to 6:212/240 of 4ymuJ

query
sites
4ymuJ
D
 
D
I
 
V
V
 
Y
K
 
K
R
 
N
F
|
F
G
 
G
A
 
S
V
 
L
T
 
E
A
x
V
L
 
L
D
 
K
G
 
G
V
 
V
S
 
T
L
 
L
T
 
K
L
 
V
K
 
N
Q
 
K
G
 
G
E
 
E
I
 
V
L
 
V
G
 
V
V
 
I
L
 
I
G
 
G
D
 
P
N
x
S
G
|
G
A
x
S
G
|
G
K
|
K
S
|
S
T
|
T
L
 
L
I
 
L
K
 
R
I
 
C
L
 
I
T
 
N
G
 
L
F
 
L
H
 
E
Q
 
E
Q
 
P
T
 
T
S
 
K
G
 
G
K
 
E
L
 
V
F
 
F
V
 
I
G
 
D
G
 
G
E
 
V
E
 
K
T
 
I
M
 
N
L
 
N
R
 
G
S
 
K
V
 
V
D
 
N
H
 
I
A
 
N
R
 
K
-
 
V
S
 
R
L
 
Q
G
 
K
I
 
V
E
 
G
C
 
M
V
 
V
Y
 
F
Q
 
Q
D
 
H
L
 
F
A
 
N
L
 
L
A
 
F
N
 
P
S
 
H
L
 
L
S
 
T
I
 
A
Y
 
I
H
 
E
N
 
N
M
 
I
F
 
T
L
 
L
N
 
A
R
 
P
E
 
V
I
 
K
I
 
V
R
 
K
R
 
K
G
 
-
P
 
-
F
 
-
R
 
-
L
 
-
L
 
M
D
 
N
N
 
K
R
 
K
A
 
E
M
 
A
R
 
E
E
 
E
R
 
L
A
 
A
A
 
V
E
 
D
C
 
L
L
 
L
E
 
A
E
 
K
I
 
V
G
 
G
V
 
L
H
 
L
V
 
D
P
 
K
S
 
K
V
 
D
D
 
Q
L
 
Y
P
 
P
V
 
I
E
 
-
Q
 
K
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
K
Q
 
Q
A
 
R
I
 
L
A
 
A
V
 
I
A
 
A
R
 
R
A
 
A
V
 
L
N
 
A
S
 
M
N
 
Q
A
 
P
K
 
E
I
 
V
L
 
M
L
 
L
L
 
F
D
 
D
E
|
E
P
 
P
L
 
T
A
 
S
A
 
A
M
 
L
G
 
D
A
 
P
R
 
E
E
 
M
A
 
V
G
 
K
L
 
E
I
 
V
I
 
L
D
 
N
L
 
V
I
 
M
L
 
K
R
 
Q
L
 
L
K
 
-
A
 
A
K
 
N
G
 
E
G
 
G
L
 
M
S
 
T
I
 
M
V
 
V
M
 
V
I
 
V
M
 
T
H
|
H
N
 
E
Y
 
M
A
 
G
Q
 
F
T
 
A
L
 
R
D
 
E
I
 
V
A
 
G
D
 
D
R
 
R
V
 
V
M
 
I
L
 
F
M
 
M
Q
 
D
R
 
D
G
 
G

3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 83% coverage: 15:226/256 of query aligns to 11:216/242 of 3c4jA

query
sites
3c4jA
K
 
K
R
 
S
F
|
F
G
 
G
A
 
S
V
 
L
T
 
E
A
x
V
L
 
L
D
 
K
G
 
G
V
 
I
S
 
N
L
 
V
T
 
H
L
 
I
K
 
R
Q
 
E
G
 
G
E
 
E
I
 
V
L
 
V
G
 
V
V
 
V
L
 
I
G
 
G
D
 
P
N
x
S
G
|
G
A
x
S
G
|
G
K
|
K
S
|
S
T
|
T
L
 
F
I
 
L
K
 
R
I
 
C
L
 
L
T
 
N
G
 
L
F
 
L
H
 
E
Q
 
D
Q
 
F
T
 
D
S
 
E
G
 
G
K
 
E
L
 
I
F
 
I
V
 
I
G
 
D
G
 
G
-
 
I
-
 
N
-
 
L
-
 
K
-
 
A
E
 
K
E
 
D
T
 
T
M
 
N
L
 
L
R
 
N
S
 
K
V
 
V
D
 
R
H
 
E
A
 
E
R
 
-
S
 
-
L
 
-
G
 
-
I
 
V
E
 
G
C
 
M
V
 
V
Y
 
F
Q
 
Q
D
 
R
L
 
F
A
 
N
L
 
L
A
 
F
N
 
P
S
 
H
L
 
M
S
 
T
I
 
V
Y
 
L
H
 
N
N
 
N
M
 
I
F
 
T
L
 
L
N
 
A
R
 
P
E
 
M
I
 
K
I
 
V
R
 
R
R
 
K
G
 
W
P
 
P
F
 
R
R
 
E
L
 
K
L
 
A
D
 
E
N
 
A
R
 
K
A
 
A
M
 
M
R
 
-
E
 
-
R
 
-
A
 
-
A
 
-
E
 
E
C
 
L
L
 
L
E
 
D
E
 
K
I
 
V
G
 
G
V
 
L
H
 
K
V
 
D
P
 
K
S
 
A
V
 
H
D
 
A
L
 
Y
P
 
P
V
 
-
E
 
D
Q
 
S
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
A
Q
 
Q
A
 
R
I
 
V
A
 
A
V
 
I
A
 
A
R
 
R
A
 
A
V
 
L
N
 
A
S
 
M
N
 
E
A
 
P
K
 
K
I
 
I
L
 
M
L
 
L
L
 
F
D
 
D
E
 
E
P
 
P
L
 
T
A
 
S
A
 
A
M
 
L
G
 
D
A
 
P
R
 
E
E
 
M
A
 
V
G
 
G
L
 
E
I
 
V
I
 
L
D
 
S
L
 
V
I
 
M
L
 
K
R
 
Q
L
 
L
K
 
-
A
 
A
K
 
N
G
 
E
G
 
G
L
 
M
S
 
T
I
 
M
V
 
V
M
 
V
I
 
V
M
 
T
H
 
H
N
 
E
Y
 
M
A
 
G
Q
 
F
T
 
A
L
 
R
D
 
E
I
 
V
A
 
G
D
 
D
R
 
R
V
 
V
M
 
L
L
 
F
M
 
M
Q
 
D
R
 
G
G
 
G
R
 
Y
V
 
I

3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 83% coverage: 15:226/256 of query aligns to 11:216/242 of 3c41J

query
sites
3c41J
K
 
K
R
 
S
F
|
F
G
 
G
A
 
S
V
 
L
T
 
E
A
x
V
L
 
L
D
 
K
G
 
G
V
 
I
S
 
N
L
 
V
T
 
H
L
 
I
K
 
R
Q
 
E
G
 
G
E
 
E
I
 
V
L
 
V
G
 
V
V
 
V
L
 
I
G
 
G
D
 
P
N
x
S
G
|
G
A
 
S
G
|
G
K
|
K
S
|
S
T
|
T
L
 
F
I
 
L
K
 
R
I
 
C
L
 
L
T
 
N
G
 
L
F
 
L
H
 
E
Q
 
D
Q
 
F
T
 
D
S
 
E
G
 
G
K
 
E
L
 
I
F
 
I
V
 
I
G
 
D
G
 
G
-
 
I
-
 
N
-
 
L
-
 
K
-
 
A
E
 
K
E
 
D
T
 
T
M
 
N
L
 
L
R
 
N
S
 
K
V
 
V
D
 
R
H
 
E
A
 
E
R
 
-
S
 
-
L
 
-
G
 
-
I
 
V
E
 
G
C
 
M
V
 
V
Y
 
F
Q
 
Q
D
 
R
L
 
F
A
 
N
L
 
L
A
 
F
N
 
P
S
 
H
L
 
M
S
 
T
I
 
V
Y
 
L
H
 
N
N
 
N
M
 
I
F
 
T
L
 
L
N
 
A
R
 
P
E
 
M
I
 
K
I
 
V
R
 
R
R
 
K
G
 
W
P
 
P
F
 
R
R
 
E
L
 
K
L
 
A
D
 
E
N
 
A
R
 
K
A
 
A
M
 
M
R
 
-
E
 
-
R
 
-
A
 
-
A
 
-
E
 
E
C
 
L
L
 
L
E
 
D
E
 
K
I
 
V
G
 
G
V
 
L
H
 
K
V
 
D
P
 
K
S
 
A
V
 
H
D
 
A
L
 
Y
P
 
P
V
 
-
E
 
D
Q
 
S
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
A
Q
 
Q
A
 
R
I
 
V
A
 
A
V
 
I
A
 
A
R
 
R
A
 
A
V
 
L
N
 
A
S
 
M
N
 
E
A
 
P
K
 
K
I
 
I
L
 
M
L
 
L
L
 
F
D
|
D
E
 
E
P
 
P
L
 
T
A
 
S
A
 
A
M
 
L
G
 
D
A
 
P
R
 
E
E
 
M
A
 
V
G
 
G
L
 
E
I
 
V
I
 
L
D
 
S
L
 
V
I
 
M
L
 
K
R
 
Q
L
 
L
K
 
-
A
 
A
K
 
N
G
 
E
G
 
G
L
 
M
S
 
T
I
 
M
V
 
V
M
 
V
I
 
V
M
 
T
H
 
H
N
 
E
Y
 
M
A
 
G
Q
 
F
T
 
A
L
 
R
D
 
E
I
 
V
A
 
G
D
 
D
R
 
R
V
 
V
M
 
L
L
 
F
M
 
M
Q
 
D
R
 
G
G
 
G
R
 
Y
V
 
I

2olkA Abc protein artp in complex with adp-beta-s
28% identity, 83% coverage: 15:226/256 of query aligns to 11:216/242 of 2olkA

query
sites
2olkA
K
 
K
R
 
S
F
|
F
G
 
G
A
 
S
V
 
L
T
 
E
A
x
V
L
 
L
D
 
K
G
 
G
V
 
I
S
 
N
L
 
V
T
 
H
L
 
I
K
 
R
Q
 
E
G
 
G
E
 
E
I
 
V
L
 
V
G
 
V
V
 
V
L
 
I
G
 
G
D
 
P
N
x
S
G
|
G
A
x
S
G
|
G
K
|
K
S
|
S
T
|
T
L
 
F
I
 
L
K
 
R
I
 
C
L
 
L
T
 
N
G
 
L
F
 
L
H
 
E
Q
 
D
Q
 
F
T
 
D
S
 
E
G
 
G
K
 
E
L
 
I
F
 
I
V
 
I
G
 
D
G
 
G
-
 
I
-
 
N
-
 
L
-
 
K
-
 
A
E
 
K
E
 
D
T
 
T
M
 
N
L
 
L
R
 
N
S
 
K
V
 
V
D
 
R
H
 
E
A
 
E
R
 
-
S
 
-
L
 
-
G
 
-
I
 
V
E
 
G
C
 
M
V
 
V
Y
 
F
Q
 
Q
D
 
R
L
 
F
A
 
N
L
 
L
A
 
F
N
 
P
S
 
H
L
 
M
S
 
T
I
 
V
Y
 
L
H
 
N
N
 
N
M
 
I
F
 
T
L
 
L
N
 
A
R
 
P
E
 
M
I
 
K
I
 
V
R
 
R
R
 
K
G
 
W
P
 
P
F
 
R
R
 
E
L
 
K
L
 
A
D
 
E
N
 
A
R
 
K
A
 
A
M
 
M
R
 
-
E
 
-
R
 
-
A
 
-
A
 
-
E
 
E
C
 
L
L
 
L
E
 
D
E
 
K
I
 
V
G
 
G
V
 
L
H
 
K
V
 
D
P
 
K
S
 
A
V
 
H
D
 
A
L
 
Y
P
 
P
V
 
-
E
 
D
Q
 
S
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
A
Q
 
Q
A
 
R
I
 
V
A
 
A
V
 
I
A
 
A
R
 
R
A
 
A
V
 
L
N
 
A
S
 
M
N
 
E
A
 
P
K
 
K
I
 
I
L
 
M
L
 
L
L
 
F
D
 
D
E
 
E
P
 
P
L
 
T
A
 
S
A
 
A
M
 
L
G
 
D
A
 
P
R
 
E
E
 
M
A
 
V
G
 
G
L
 
E
I
 
V
I
 
L
D
 
S
L
 
V
I
 
M
L
 
K
R
 
Q
L
 
L
K
 
-
A
 
A
K
 
N
G
 
E
G
 
G
L
 
M
S
 
T
I
 
M
V
 
V
M
 
V
I
 
V
M
 
T
H
 
H
N
 
E
Y
 
M
A
 
G
Q
 
F
T
 
A
L
 
R
D
 
E
I
 
V
A
 
G
D
 
D
R
 
R
V
 
V
M
 
L
L
 
F
M
 
M
Q
 
D
R
 
G
G
 
G
R
 
Y
V
 
I

2oljA Abc protein artp in complex with adp/mg2+
28% identity, 83% coverage: 15:226/256 of query aligns to 11:216/242 of 2oljA

query
sites
2oljA
K
 
K
R
 
S
F
|
F
G
 
G
A
 
S
V
 
L
T
 
E
A
x
V
L
 
L
D
 
K
G
 
G
V
 
I
S
 
N
L
 
V
T
 
H
L
 
I
K
 
R
Q
 
E
G
 
G
E
 
E
I
 
V
L
 
V
G
 
V
V
 
V
L
 
I
G
 
G
D
 
P
N
x
S
G
|
G
A
x
S
G
|
G
K
|
K
S
|
S
T
|
T
L
 
F
I
 
L
K
 
R
I
 
C
L
 
L
T
 
N
G
 
L
F
 
L
H
 
E
Q
 
D
Q
 
F
T
 
D
S
 
E
G
 
G
K
 
E
L
 
I
F
 
I
V
 
I
G
 
D
G
 
G
-
 
I
-
 
N
-
 
L
-
 
K
-
 
A
E
 
K
E
 
D
T
 
T
M
 
N
L
 
L
R
 
N
S
 
K
V
 
V
D
 
R
H
 
E
A
 
E
R
 
-
S
 
-
L
 
-
G
 
-
I
 
V
E
 
G
C
 
M
V
 
V
Y
 
F
Q
 
Q
D
 
R
L
 
F
A
 
N
L
 
L
A
 
F
N
 
P
S
 
H
L
 
M
S
 
T
I
 
V
Y
 
L
H
 
N
N
 
N
M
 
I
F
 
T
L
 
L
N
 
A
R
 
P
E
 
M
I
 
K
I
 
V
R
 
R
R
 
K
G
 
W
P
 
P
F
 
R
R
 
E
L
 
K
L
 
A
D
 
E
N
 
A
R
 
K
A
 
A
M
 
M
R
 
-
E
 
-
R
 
-
A
 
-
A
 
-
E
 
E
C
 
L
L
 
L
E
 
D
E
 
K
I
 
V
G
 
G
V
 
L
H
 
K
V
 
D
P
 
K
S
 
A
V
 
H
D
 
A
L
 
Y
P
 
P
V
 
-
E
 
D
Q
 
S
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
A
Q
 
Q
A
 
R
I
 
V
A
 
A
V
 
I
A
 
A
R
 
R
A
 
A
V
 
L
N
 
A
S
 
M
N
 
E
A
 
P
K
 
K
I
 
I
L
 
M
L
 
L
L
 
F
D
 
D
E
 
E
P
 
P
L
 
T
A
 
S
A
 
A
M
 
L
G
 
D
A
 
P
R
 
E
E
 
M
A
 
V
G
 
G
L
 
E
I
 
V
I
 
L
D
 
S
L
 
V
I
 
M
L
 
K
R
 
Q
L
 
L
K
 
-
A
 
A
K
 
N
G
 
E
G
 
G
L
 
M
S
 
T
I
 
M
V
 
V
M
 
V
I
 
V
M
 
T
H
 
H
N
 
E
Y
 
M
A
 
G
Q
 
F
T
 
A
L
 
R
D
 
E
I
 
V
A
 
G
D
 
D
R
 
R
V
 
V
M
 
L
L
 
F
M
 
M
Q
 
D
R
 
G
G
 
G
R
 
Y
V
 
I

1g291 Malk (see paper)
27% identity, 83% coverage: 12:224/256 of query aligns to 8:216/372 of 1g291

query
sites
1g291
D
 
D
I
 
V
V
 
W
K
 
K
R
 
V
F
 
F
G
 
G
A
 
E
V
 
V
T
 
T
A
 
A
L
 
V
D
 
R
G
 
E
V
 
M
S
 
S
L
 
L
T
 
E
L
 
V
K
 
K
Q
 
D
G
 
G
E
 
E
I
 
F
L
 
M
G
 
I
V
 
L
L
 
L
G
 
G
D
 
P
N
x
S
G
|
G
A
x
C
G
|
G
K
|
K
S
x
T
T
|
T
L
 
T
I
 
L
K
 
R
I
 
M
L
 
I
T
 
A
G
 
G
F
 
L
H
 
E
Q
 
E
Q
 
P
T
 
S
S
 
R
G
 
G
K
 
Q
L
 
I
F
 
Y
V
 
I
G
 
G
G
 
-
E
 
-
E
 
D
T
 
K
M
 
L
L
 
V
R
 
A
S
x
D
V
 
P
D
x
E
H
x
K
-
 
G
-
 
I
-
 
F
-
 
V
-
 
P
A
 
P
R
x
K
S
x
D
L
 
R
G
 
D
I
 
I
E
 
A
C
 
M
V
 
V
Y
 
F
Q
 
Q
D
 
S
L
 
Y
A
 
A
L
 
L
A
 
Y
N
 
P
S
 
H
L
 
M
S
 
T
I
 
V
Y
 
Y
H
 
D
N
 
N
M
 
I
F
 
A
L
 
F
N
 
P
R
 
L
E
 
K
I
 
-
I
 
L
R
 
R
R
 
K
G
 
V
P
 
P
F
 
R
R
 
Q
L
 
E
L
 
I
D
 
D
N
 
Q
R
 
R
A
 
V
M
 
R
R
 
E
E
 
V
R
 
A
A
 
E
A
 
L
E
 
L
C
 
G
L
 
L
E
 
T
E
 
E
I
 
L
G
 
L
V
 
N
H
 
R
V
 
K
P
 
P
S
 
-
V
 
-
D
 
-
L
 
-
P
 
-
V
 
-
E
 
R
Q
 
E
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
R
Q
 
Q
A
 
R
I
 
V
A
 
A
V
 
L
A
 
G
R
 
R
A
 
A
V
 
I
N
 
V
S
 
R
N
 
K
A
 
P
K
 
Q
I
 
V
L
 
F
L
 
L
L
 
M
D
 
D
E
 
E
P
 
P
L
 
L
A
 
S
A
 
N
M
 
L
G
 
D
A
 
A
R
 
K
E
 
L
A
 
R
G
 
V
L
 
R
I
 
M
I
 
R
D
 
A
L
 
E
I
 
L
L
 
K
R
 
K
L
 
L
K
 
Q
A
 
R
K
 
Q
G
 
L
G
 
G
L
 
V
S
 
T
I
 
T
V
 
I
M
 
Y
I
 
V
M
 
T
H
 
H
N
 
D
Y
 
Q
A
 
V
Q
 
E
T
 
A
L
 
M
D
 
T
I
 
M
A
 
G
D
 
D
R
 
R
V
 
I
M
 
A
L
 
V
M
 
M
Q
 
N
R
 
R
G
 
G

Sites not aligning to the query:

P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 82% coverage: 19:229/256 of query aligns to 17:222/343 of P30750

query
sites
P30750
A
 
T
V
 
I
T
 
Q
A
 
A
L
 
L
D
 
N
G
 
N
V
 
V
S
 
S
L
 
L
T
 
H
L
 
V
K
 
P
Q
 
A
G
 
G
E
 
Q
I
 
I
L
 
Y
G
 
G
V
 
V
L
 
I
G
 
G
D
 
A
N
x
S
G
|
G
A
|
A
G
|
G
K
|
K
S
|
S
T
|
T
L
 
L
I
 
I
K
 
R
I
 
C
L
 
V
T
 
N
G
 
L
F
 
L
H
 
E
Q
 
R
Q
 
P
T
 
T
S
 
E
G
 
G
K
 
S
L
 
V
F
 
L
V
 
V
G
 
D
G
 
G
E
 
Q
E
 
E
T
 
L
M
 
T
L
 
T
R
 
L
S
 
S
-
 
E
-
 
S
-
 
E
-
 
L
V
 
T
D
 
K
H
 
A
A
 
R
R
 
R
S
 
Q
L
 
I
G
 
G
I
 
M
E
 
-
C
 
-
V
 
I
Y
 
F
Q
 
Q
D
 
H
L
 
F
A
 
N
L
 
L
A
 
L
N
 
S
S
 
S
L
 
R
S
 
T
I
 
V
Y
 
F
H
 
G
N
 
N
M
 
V
F
 
A
L
 
L
N
 
P
R
 
L
E
 
E
I
 
-
I
 
-
R
 
-
R
 
-
G
 
-
P
 
-
F
 
-
R
 
-
L
 
-
L
 
L
D
 
D
N
 
N
R
 
T
A
 
P
-
 
K
-
 
D
-
 
E
M
 
V
R
 
K
E
 
R
R
 
R
A
 
V
A
 
T
E
 
E
C
 
L
L
 
L
E
 
S
E
 
L
I
 
V
G
 
G
V
 
L
H
 
G
V
 
D
P
 
K
S
 
H
V
 
D
D
 
S
L
 
Y
P
 
P
V
 
-
E
 
S
Q
 
N
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
Q
R
 
K
Q
 
Q
A
 
R
I
 
V
A
 
A
V
 
I
A
 
A
R
 
R
A
 
A
V
 
L
N
 
A
S
 
S
N
 
N
A
 
P
K
 
K
I
 
V
L
 
L
L
 
L
L
 
C
D
 
D
E
|
E
P
 
A
L
 
T
A
 
S
A
 
A
M
 
L
G
 
D
A
 
P
R
 
A
E
 
T
A
 
T
G
 
R
L
 
S
I
 
I
I
 
L
D
 
E
L
 
L
I
 
L
L
 
K
R
 
D
L
 
I
K
 
N
A
 
R
K
 
R
G
 
L
G
 
G
L
 
L
S
 
T
I
 
I
V
 
L
M
 
L
I
 
I
M
 
T
H
 
H
N
 
E
Y
 
M
A
 
D
Q
 
V
T
 
V
L
 
K
D
 
R
I
 
I
A
 
C
D
 
D
R
 
C
V
 
V
M
 
A
L
 
V
M
 
I
Q
 
S
R
 
N
G
 
G
R
 
E
V
 
L
T
 
I
Y
 
E
Q
 
Q

Sites not aligning to the query:

2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
31% identity, 86% coverage: 6:226/256 of query aligns to 2:216/223 of 2pclA

query
sites
2pclA
E
 
E
A
 
I
L
 
L
R
 
R
G
 
A
E
 
E
D
 
N
I
 
I
V
 
K
K
 
K
R
 
V
F
 
I
G
 
R
A
 
G
V
 
Y
T
 
E
A
 
I
L
 
L
D
 
K
G
 
G
V
 
I
S
 
S
L
 
L
T
 
S
L
 
V
K
 
K
Q
 
K
G
 
G
E
 
E
I
 
F
L
 
V
G
 
S
V
 
I
L
 
I
G
 
G
D
 
A
N
 
S
G
 
G
A
 
S
G
 
G
K
 
K
S
 
S
T
 
T
L
 
L
I
 
L
K
 
Y
I
 
I
L
 
L
T
 
G
G
 
L
F
 
L
H
 
D
Q
 
A
Q
 
P
T
 
T
S
 
E
G
 
G
K
 
K
L
 
V
F
 
F
V
 
L
G
 
E
G
 
G
E
 
K
E
 
E
-
 
V
-
 
D
-
 
Y
T
 
T
M
 
N
L
 
E
R
 
K
S
 
E
V
 
L
D
 
S
H
 
L
A
 
L
R
 
R
S
 
N
L
 
R
G
 
K
I
 
L
E
 
G
C
 
F
V
 
V
Y
 
F
Q
 
Q
D
 
F
L
 
H
A
 
Y
L
 
L
A
 
I
N
 
P
S
 
E
L
 
L
S
 
T
I
 
A
Y
 
L
H
 
E
N
 
N
M
 
V
F
 
I
L
 
V
N
 
-
R
 
-
E
 
P
I
 
M
I
 
L
R
 
K
R
 
M
G
 
G
P
 
K
F
 
-
R
 
-
L
 
-
L
 
-
D
 
P
N
 
K
R
 
K
A
 
E
M
 
A
R
 
K
E
 
E
R
 
R
A
 
G
A
 
E
E
 
Y
C
 
L
L
 
L
E
 
S
E
 
E
I
 
L
G
 
G
V
 
L
H
 
G
V
 
D
P
 
K
S
 
L
V
 
S
D
 
R
L
 
K
P
 
P
V
 
Y
E
 
E
Q
 
-
L
 
L
S
 
S
G
 
G
G
 
G
Q
 
E
R
 
Q
Q
 
Q
A
 
R
I
 
V
A
 
A
V
 
I
A
 
A
R
 
R
A
 
A
V
 
L
N
 
A
S
 
N
N
 
E
A
 
P
K
 
I
I
 
L
L
 
L
L
 
F
L
 
A
D
 
D
E
|
E
P
|
P
L
x
T
A
 
G
A
 
N
M
 
L
G
 
D
A
 
S
R
 
A
E
 
N
A
 
T
G
 
K
L
 
R
I
 
V
I
 
M
D
 
D
L
 
I
I
 
F
L
 
L
R
 
K
L
 
I
K
 
N
A
 
-
K
 
E
G
 
G
G
 
G
L
 
T
S
 
S
I
 
I
V
 
V
M
 
M
I
 
V
M
x
T
H
 
H
N
 
E
Y
 
-
A
 
R
Q
 
E
T
 
L
L
 
A
D
 
E
I
 
L
A
 
T
D
 
H
R
 
R
V
 
T
M
 
L
L
 
E
M
 
M
Q
 
K
R
 
D
G
 
G
R
 
K
V
 
V

Query Sequence

>BPHYT_RS30865 FitnessBrowser__BFirm:BPHYT_RS30865
MSDVLEALRGEDIVKRFGAVTALDGVSLTLKQGEILGVLGDNGAGKSTLIKILTGFHQQT
SGKLFVGGEETMLRSVDHARSLGIECVYQDLALANSLSIYHNMFLNREIIRRGPFRLLDN
RAMRERAAECLEEIGVHVPSVDLPVEQLSGGQRQAIAVARAVNSNAKILLLDEPLAAMGA
REAGLIIDLILRLKAKGGLSIVMIMHNYAQTLDIADRVMLMQRGRVTYQREAASTSVEEL
MEIVRREYRAMRAPSH

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory