Comparing BPHYT_RS30940 FitnessBrowser__BFirm:BPHYT_RS30940 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pfmA Shewanella benthica dhdps with lysine and pyruvate
27% identity, 69% coverage: 11:232/322 of query aligns to 3:218/295 of 4pfmA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
24% identity, 67% coverage: 10:226/322 of query aligns to 1:211/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
24% identity, 67% coverage: 10:226/322 of query aligns to 1:211/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
24% identity, 67% coverage: 10:226/322 of query aligns to 1:211/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
24% identity, 67% coverage: 10:226/322 of query aligns to 1:211/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
24% identity, 67% coverage: 10:226/322 of query aligns to 1:211/291 of 3rk8A
Sites not aligning to the query:
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
24% identity, 67% coverage: 10:226/322 of query aligns to 1:211/291 of 3pueB
Sites not aligning to the query:
5c55A Crystal structure of the y138f mutant of c.Glutamicum n- acetylneuraminic acid lyase in complex with pyruvate
26% identity, 69% coverage: 10:232/322 of query aligns to 1:223/307 of 5c55A
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
32% identity, 35% coverage: 12:123/322 of query aligns to 3:114/294 of 4i7wA
Sites not aligning to the query:
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
31% identity, 35% coverage: 12:123/322 of query aligns to 3:114/294 of Q8UGL3
Sites not aligning to the query:
Q1JUQ0 L-2-keto-3-deoxyarabonate dehydratase; L-KDA dehydratase; 2-dehydro-3-deoxy-L-arabinonate dehydratase; L-2-keto-3-deoxyarabinonate dehydratase; EC 4.2.1.43 from Azospirillum brasilense (see paper)
42% identity, 23% coverage: 13:85/322 of query aligns to 11:83/309 of Q1JUQ0
Sites not aligning to the query:
3lbcD D-sialic acid aldolase complexed with l-arabinose
26% identity, 68% coverage: 7:224/322 of query aligns to 1:212/296 of 3lbcD
2wpbA Crystal structure of the e192n mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate and the inhibitor (2r,3r)-2,3,4- trihydroxy-n,n-dipropylbutanamide in space group p21 crystal form i (see paper)
26% identity, 67% coverage: 8:224/322 of query aligns to 7:217/302 of 2wpbA
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
24% identity, 66% coverage: 13:226/322 of query aligns to 5:215/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
24% identity, 66% coverage: 13:226/322 of query aligns to 4:214/294 of Q9X1K9
4bwlC Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
30% identity, 30% coverage: 8:103/322 of query aligns to 2:95/296 of 4bwlC
Sites not aligning to the query:
4bwlA Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
30% identity, 30% coverage: 8:103/322 of query aligns to 4:97/299 of 4bwlA
Sites not aligning to the query:
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
27% identity, 69% coverage: 11:232/322 of query aligns to 4:219/296 of 6u01B
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
26% identity, 66% coverage: 13:223/322 of query aligns to 5:209/293 of 5t25A
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
26% identity, 66% coverage: 13:223/322 of query aligns to 4:208/292 of 2atsA
>BPHYT_RS30940 FitnessBrowser__BFirm:BPHYT_RS30940
MTTSKQFATSIEGIVPVMLTPFDDAGAIDYAGLERLIEWYIAHGSDALFAVAQSSEMQFL
TLAERGALGRFVVDKVAGRIPVVVSGHISDDPDAQAEELNVAAATGAQGIVLVTNRLDPK
QQGTQTFAANLRQLLARLPSDVPLGLYECPAPYRRLLSDDELKLCIDTGRFIMLKDVSCD
LATVKRRVALAEGSPLKILNANAAIAWDAMKAGSAGFNGVFTNFHPDLYKWLRNDAAQDP
ALAEELATFLVLAAVSESLGYPAFAKIYHQRIGTFDSIRCRVIDYDVRERFWALDAVLDK
IVVGTEHFRSRIAALGANRSVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory