Comparing BPHYT_RS31070 FitnessBrowser__BFirm:BPHYT_RS31070 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 62% coverage: 59:191/213 of query aligns to 62:192/203 of P07464
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
34% identity, 62% coverage: 59:191/213 of query aligns to 61:191/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
34% identity, 62% coverage: 59:191/213 of query aligns to 61:191/201 of 1kruA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
34% identity, 62% coverage: 59:191/213 of query aligns to 61:191/200 of 1krrA
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
31% identity, 75% coverage: 25:183/213 of query aligns to 53:183/186 of 4isxA
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
28% identity, 71% coverage: 32:182/213 of query aligns to 46:182/190 of 5u2kA
3mqhA Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with coa and udp-3-amino-2-acetamido-2,3-dideoxy glucuronic acid (see paper)
30% identity, 73% coverage: 27:181/213 of query aligns to 15:152/191 of 3mqhA
Sites not aligning to the query:
3mqgC Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with acetyl-coa (see paper)
29% identity, 73% coverage: 27:181/213 of query aligns to 16:153/192 of 3mqgC
Sites not aligning to the query:
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
37% identity, 40% coverage: 97:182/213 of query aligns to 95:184/188 of 3igjC
Sites not aligning to the query:
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
32% identity, 49% coverage: 78:182/213 of query aligns to 174:278/307 of A1ADJ6
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
25% identity, 76% coverage: 45:205/213 of query aligns to 13:175/191 of G3XD01
7zw9A Crystal structure of a gamma-carbonic anhydrase from the pathogenic bacterium burkholderia pseudomallei (see paper)
53% identity, 23% coverage: 133:182/213 of query aligns to 90:142/173 of 7zw9A
Sites not aligning to the query:
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
46% identity, 25% coverage: 130:182/213 of query aligns to 129:182/185 of 3nz2J
Sites not aligning to the query:
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
46% identity, 25% coverage: 130:182/213 of query aligns to 126:179/183 of 3nz2C
Sites not aligning to the query:
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
46% identity, 25% coverage: 130:182/213 of query aligns to 119:172/176 of 3ectA
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
52% identity, 25% coverage: 129:181/213 of query aligns to 193:245/261 of 6wyeA
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
29% identity, 46% coverage: 85:183/213 of query aligns to 39:142/290 of 4mzuB
Sites not aligning to the query:
2fkoA Structure of ph1591 from pyrococcus horikoshii ot3 (see paper)
31% identity, 30% coverage: 131:193/213 of query aligns to 71:153/173 of 2fkoA
Sites not aligning to the query:
1v3wA Structure of ferripyochelin binding protein from pyrococcus horikoshii ot3 (see paper)
31% identity, 30% coverage: 131:193/213 of query aligns to 71:153/173 of 1v3wA
Sites not aligning to the query:
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
52% identity, 25% coverage: 129:181/213 of query aligns to 191:243/243 of 7ra4A
Sites not aligning to the query:
>BPHYT_RS31070 FitnessBrowser__BFirm:BPHYT_RS31070
MNIGIFFKVRNRLRTSLQGLIYPFFFARFGARSRILRPIRIDGSDNIAIGTDVFVNNFAW
IETIRAFSVQPRLDIRDRVYIGNSAHIIVTHSIEIGCDVLIADRVYVADYIHGYEDIHTP
VKTQDLIQRRPVNIGDGSWIGENVVILGARIGRHCVIGANAVVTSDIPDFCVAVGAPARV
VRHWHPDRKQWLKGAPSARAACSASVTNEINHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory