SitesBLAST
Comparing BPHYT_RS31135 FitnessBrowser__BFirm:BPHYT_RS31135 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
27% identity, 94% coverage: 16:418/429 of query aligns to 11:423/430 of P0AA76
- Y29 (= Y34) binding
- D31 (= D36) mutation to N: Loss of galactonate transport activity.
- R32 (= R37) binding
- Y64 (= Y69) binding
- E118 (= E123) mutation to Q: Loss of galactonate transport activity.
- W358 (≠ V353) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
27% identity, 94% coverage: 17:418/429 of query aligns to 1:404/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
26% identity, 94% coverage: 16:418/429 of query aligns to 3:388/393 of 6e9oA
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 76% coverage: 77:402/429 of query aligns to 143:483/582 of Q9JI12
- R184 (= R116) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E123) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (vs. gap) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Sites not aligning to the query:
- 88 R→A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
- 128 H→A: Greatly lowers L-glutamate transport.
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
25% identity, 76% coverage: 77:402/429 of query aligns to 85:425/452 of 7t3nA
Sites not aligning to the query:
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
26% identity, 49% coverage: 65:274/429 of query aligns to 115:329/495 of Q9NRA2
- K136 (= K86) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ I131) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ AT 146:147) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ I- 213) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ NSDRD 214:218) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G273) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
- 334 P → R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- 371 G → V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
29% identity, 41% coverage: 98:274/429 of query aligns to 155:329/495 of Q5Q0U0
- R168 (= R116) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ L119) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G120) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E123) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ A124) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (= F127) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P128) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ I131) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ T134) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ SDRDE 215:219) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
- 136 K→E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- 334 P→R: Abolishes H(+)-coupled sialic acid transporter activity.
- 371 G→V: Remains in the endoplasmic reticulum.
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
27% identity, 49% coverage: 65:274/429 of query aligns to 115:329/495 of Q8BN82
- H183 (≠ I131) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
24% identity, 52% coverage: 2:226/429 of query aligns to 10:234/448 of Q51955
- D41 (≠ N33) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D36) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G77) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D81) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (≠ S84) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R116) mutation to A: Abolishes 4-HBA transport.
- E144 (≠ L136) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R175) mutation to A: Decrease in 4-HBA transport and chemotaxis.
Sites not aligning to the query:
- 323 D→N: Abolishes 4-HBA transport and chemotaxis.
- 328 H→A: Decrease in 4-HBA transport and chemotaxis.; H→R: Decrease in 4-HBA transport and loss of chemotaxis.
- 386 R→A: Strong decrease in 4-HBA transport.
- 398 R→A: Abolishes 4-HBA transport.
- 444 H→A: No change in 4-HBA transport and chemotaxis.
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
25% identity, 51% coverage: 77:296/429 of query aligns to 102:337/493 of Q03567
Sites not aligning to the query:
- 69 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
23% identity, 80% coverage: 4:346/429 of query aligns to 5:361/452 of Q5EXK5
- D82 (= D81) mutation to A: Loss of activity.
- V311 (≠ R296) mutation to W: Loss of activity.
- D314 (≠ Q299) mutation to A: Loss of activity.
Q9GQQ0 Protein spinster; Protein benchwarmer; Protein diphthong from Drosophila melanogaster (Fruit fly) (see paper)
27% identity, 67% coverage: 13:300/429 of query aligns to 107:394/605 of Q9GQQ0
- E217 (= E123) mutation to K: In bnch(N); leads to storage in yolk spheres during oogenesis and results in widespread accumulation of enlarged lysosomal and late endosomal inclusions.
Q9C0U9 Uncharacterized transporter PB1C11.03 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 46% coverage: 47:242/429 of query aligns to 128:336/570 of Q9C0U9
Sites not aligning to the query:
- 14 modified: Phosphoserine
Q8IVW8 Sphingosine-1-phosphate transporter SPNS2; Protein spinster homolog 2 from Homo sapiens (Human) (see 2 papers)
23% identity, 59% coverage: 14:265/429 of query aligns to 96:344/549 of Q8IVW8
- R200 (= R116) mutation to S: Loss of function; does not rescue the cardia bifida phenotype in the morpholino knockdown in zebrafish.
- S319 (≠ K243) natural variant: Missing (in DFNB115; uncertain significance; dbSNP:rs749994718)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
24% identity, 53% coverage: 70:297/429 of query aligns to 91:314/444 of Q8NLB7
- R103 (= R82) mutation to A: Loss of transport activity.
- W309 (= W292) mutation to V: Loss of transport activity.
- D312 (≠ S295) mutation to A: Loss of transport activity.
- R313 (= R296) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 57 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
7yubR S1p-bound human spns2 (see paper)
24% identity, 38% coverage: 14:174/429 of query aligns to 4:169/429 of 7yubR
Sites not aligning to the query:
8jhqA Cryo-em structure of human s1p transporter spns2 bound with s1p (see paper)
22% identity, 59% coverage: 14:265/429 of query aligns to 2:249/446 of 8jhqA
Sites not aligning to the query:
Query Sequence
>BPHYT_RS31135 FitnessBrowser__BFirm:BPHYT_RS31135
MKILEAGSVADQTAVGRYRWTICALIFFATTINYMDRQMLGLLAPLLQKDIGWTQVQYAQ
TVMVFTVAYAVGLATFGRIADRISTKVVYGGAMAMWSLAAMLHAIAATVPGFAAVRGLLG
FGEAANFPVAIRTTALWFPKKERALATGLWNMGATVGGIVAPAFVPIAAVMWGWRATFIA
GGAAGFVWLAVWLLVYRPPAEHASVSKRELDYINSDRDESVEQRVSWLSVLKYRETWAFI
FGKLLTDPVWWFYLFWLPKWLNESRHIDIANLGLPLIVIYTMASVGSVAGGWLSSRLMQR
SHKPNVARKIAMGVCALCVLPIATLSLFQSLWYAVFAVGLAAAAHQGWSANLVTTVGDVF
PRRMVGTVVGIGGVAGMIGSFFYSGVIGETLQRTGQYWVLFAVGASAYLVALGIIHLLMP
RMTPVKLEH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory