Comparing BPHYT_RS31200 FitnessBrowser__BFirm:BPHYT_RS31200 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
41% identity, 92% coverage: 6:304/325 of query aligns to 5:303/326 of Q8RDH4
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
39% identity, 97% coverage: 4:319/325 of query aligns to 2:324/330 of P0AAH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
41% identity, 92% coverage: 6:304/325 of query aligns to 4:292/310 of 4fwiB
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 80% coverage: 4:262/325 of query aligns to 2:250/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 80% coverage: 4:262/325 of query aligns to 2:250/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
36% identity, 80% coverage: 4:262/325 of query aligns to 2:250/250 of 7z16I
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 77% coverage: 12:262/325 of query aligns to 29:269/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
32% identity, 77% coverage: 12:262/325 of query aligns to 29:269/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
34% identity, 72% coverage: 17:251/325 of query aligns to 36:258/260 of 7ahdC
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
34% identity, 77% coverage: 4:252/325 of query aligns to 1:232/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 78% coverage: 6:258/325 of query aligns to 2:243/343 of P30750
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 72% coverage: 3:237/325 of query aligns to 2:224/648 of P75831
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 78% coverage: 6:258/325 of query aligns to 3:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 78% coverage: 6:258/325 of query aligns to 3:244/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 78% coverage: 6:258/325 of query aligns to 3:244/344 of 6cvlD
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
30% identity, 77% coverage: 6:256/325 of query aligns to 7:229/353 of 1vciA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 73% coverage: 16:252/325 of query aligns to 8:232/240 of 4ymuJ
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 74% coverage: 16:256/325 of query aligns to 27:248/378 of P69874
Sites not aligning to the query:
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
35% identity, 73% coverage: 2:237/325 of query aligns to 1:218/218 of 7w78A
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 76% coverage: 6:252/325 of query aligns to 4:234/242 of 3c4jA
>BPHYT_RS31200 FitnessBrowser__BFirm:BPHYT_RS31200
MSTPTLSVQNLRTHFFTGAGVAKAVDDTSFDVAPGEIVGLVGESGSGKSITGFSVLGLID
APGRIVAGRVLFKGEDLTTLTPEALRRLRGNRIAMIFQDPMMTLNPVLRIDTQMIEAVQA
HTRVSKHAARQRARDALASVGIPSPDERLRAYPHQLSGGMRQRVAIAIALLHDPELIIAD
EPTTALDVTIQAQILAEMQKLCARSHTAMVWVSHDLAVVAGLADRICVMYAGRVVETGSV
DEILERPRHPYTIGLIDSLPEKARRGESLTQIPGMAPSALKLPVGCAFAPRCVYATSLCR
SAEPPVTGEGTHLFRCFHPRSGAPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory