Comparing BPHYT_RS31205 FitnessBrowser__BFirm:BPHYT_RS31205 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
36% identity, 88% coverage: 40:345/347 of query aligns to 18:320/326 of Q8RDH4
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
33% identity, 88% coverage: 40:343/347 of query aligns to 17:323/330 of P0AAH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
36% identity, 88% coverage: 40:345/347 of query aligns to 17:309/310 of 4fwiB
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 74% coverage: 43:299/347 of query aligns to 18:260/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 74% coverage: 43:299/347 of query aligns to 19:261/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 74% coverage: 43:299/347 of query aligns to 19:261/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 74% coverage: 43:299/347 of query aligns to 19:261/344 of 3tuiC
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
32% identity, 69% coverage: 48:288/347 of query aligns to 21:252/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
33% identity, 68% coverage: 48:283/347 of query aligns to 21:247/250 of 7z18I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
32% identity, 68% coverage: 48:283/347 of query aligns to 21:247/250 of 7z16I
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
31% identity, 70% coverage: 43:284/347 of query aligns to 19:247/375 of 2d62A
1g291 Malk (see paper)
31% identity, 70% coverage: 43:284/347 of query aligns to 16:244/372 of 1g291
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 68% coverage: 49:283/347 of query aligns to 20:239/240 of 4ymuJ
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 68% coverage: 45:280/347 of query aligns to 19:235/393 of P9WQI3
8hplC Lpqy-sugabc in state 1 (see paper)
31% identity, 68% coverage: 45:280/347 of query aligns to 16:232/384 of 8hplC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
31% identity, 68% coverage: 45:280/347 of query aligns to 18:234/362 of 8hprD
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
31% identity, 68% coverage: 45:280/347 of query aligns to 18:234/363 of 8hprC
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
28% identity, 74% coverage: 48:303/347 of query aligns to 20:260/371 of 3puyA
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
28% identity, 74% coverage: 48:303/347 of query aligns to 20:260/371 of 3puxA
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
28% identity, 74% coverage: 48:303/347 of query aligns to 20:260/371 of 3puwA
Sites not aligning to the query:
>BPHYT_RS31205 FitnessBrowser__BFirm:BPHYT_RS31205
MNAPHVMAPLVEVDHVSRRFVRRLNYAERIAGWLGARAEEQIVHAVDDVSLTIHRGEVLG
LVGESGCGKSTLGRMLAGIGAPSSGSIRTLEKIAEQSAPGSEHDGTRAGKRTSRHRLATQ
MIFQDPLSSLNPRKRVRDIIGEAPLVHGIVERKQLDAYVVDVMERVGLNPDFRERFPHQF
SGGQRQRIGIGRALAVKPDFLICDESIAALDVSIQAQIINLFMQLRRDLGLTYLFISHDL
GVVEHISDRVAIMYLGRIVETAPTVELFANPQHPYTIALLAQVPRLSNRKRQFESIQGEI
PSPLAPPDGCHFHPRCPHATQRCRTERPLLRQSGAAHQVACHLVEVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory