Comparing BPHYT_RS31475 FitnessBrowser__BFirm:BPHYT_RS31475 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
3no5E Crystal structure of a pfam duf849 domain containing protein (reut_a1631) from ralstonia eutropha jmp134 at 1.90 a resolution
96% identity, 100% coverage: 1:273/274 of query aligns to 2:274/275 of 3no5E
3chvA Crystal structure of a prokaryotic domain of unknown function (duf849) member (spoa0042) from silicibacter pomeroyi dss-3 at 1.45 a resolution
66% identity, 99% coverage: 2:273/274 of query aligns to 2:273/279 of 3chvA
Sites not aligning to the query:
3fa5A Crystal structure of a duf849 family protein (pden_3495) from paracoccus denitrificans pd1222 at 1.90 a resolution
64% identity, 99% coverage: 3:273/274 of query aligns to 2:273/276 of 3fa5A
2y7gA Crystal structure of the 3-keto-5-aminohexanoate cleavage enzyme (kce) from c. Cloacamonas acidaminovorans in complex with the product acetoacetate (see paper)
41% identity, 100% coverage: 2:274/274 of query aligns to 2:276/276 of 2y7gA
2y7fD Crystal structure of the 3-keto-5-aminohexanoate cleavage enzyme (kce) from c. Cloacamonas acidaminovorans in complex with the substrate 3- keto-5-aminohexanoate (see paper)
41% identity, 100% coverage: 2:274/274 of query aligns to 3:277/277 of 2y7fD
2y7fA Crystal structure of the 3-keto-5-aminohexanoate cleavage enzyme (kce) from c. Cloacamonas acidaminovorans in complex with the substrate 3- keto-5-aminohexanoate (see paper)
41% identity, 100% coverage: 2:274/274 of query aligns to 3:277/277 of 2y7fA
2y7dD Crystal structure of the 3-keto-5-aminohexanoate cleavage enzyme (kce) from candidatus cloacamonas acidaminovorans (orthorombic form) (see paper)
41% identity, 100% coverage: 2:274/274 of query aligns to 4:278/278 of 2y7dD
B0VHH0 3-keto-5-aminohexanoate cleavage enzyme; EC 2.3.1.247 from Cloacimonas acidaminovorans (strain Evry) (see paper)
42% identity, 99% coverage: 3:274/274 of query aligns to 2:275/276 of B0VHH0
3lotD Crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution
30% identity, 99% coverage: 5:274/274 of query aligns to 7:306/313 of 3lotD
3e49A Crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution
28% identity, 99% coverage: 2:273/274 of query aligns to 1:299/307 of 3e49A
3e02A Crystal structure of a duf849 family protein (bxe_c0271) from burkholderia xenovorans lb400 at 1.90 a resolution
30% identity, 99% coverage: 2:272/274 of query aligns to 4:301/310 of 3e02A
5zmuD Crystal structure of a cis-epoxysuccinate hydrolase producing d(-)- tartaric acids (see paper)
29% identity, 98% coverage: 6:273/274 of query aligns to 5:287/287 of 5zmuD
5zmyA Crystal structure of a cis-epoxysuccinate hydrolase producing d(-)- tartaric acids (see paper)
29% identity, 98% coverage: 6:273/274 of query aligns to 5:280/280 of 5zmyA
5ikzA Glycerol bound structure of obc1, a bifunctional enzyme for quorum sensing-dependent oxalogenesis (see paper)
25% identity, 57% coverage: 16:172/274 of query aligns to 189:374/1047 of 5ikzA
Sites not aligning to the query:
5ikyA Apo structure of obc1, a bifunctional enzyme for quorum sensing- dependent oxalogenesis (see paper)
25% identity, 57% coverage: 16:172/274 of query aligns to 189:374/1048 of 5ikyA
Sites not aligning to the query:
4nncA Ternary complex of obca with c4-coa adduct and oxalate (see paper)
30% identity, 51% coverage: 18:156/274 of query aligns to 153:319/483 of 4nncA
Sites not aligning to the query:
4nnbA Binary complex of obca with oxaloacetate (see paper)
30% identity, 51% coverage: 18:156/274 of query aligns to 152:318/484 of 4nnbA
Sites not aligning to the query:
4nnaA Apo structure of obca (see paper)
30% identity, 51% coverage: 18:156/274 of query aligns to 166:332/498 of 4nnaA
Sites not aligning to the query:
>BPHYT_RS31475 FitnessBrowser__BFirm:BPHYT_RS31475
MNKPCIISVAITGSLPRKKDNPAVPITVNEQVESTQAAFEAGASLVHLHVRNDDETPTSN
PDRFALVLEGIRKHAPGMITQVSTGGRSGAGNERGAMLSLRPDMASLATGSVNFPTRVYD
NPPDLIDWLAAEMKAYGIKPEVEAFDLSMIFQAAAMQAAGAIVGPLHIQFVMGIKNAMPV
DREVLEFYVRTLKRLSPDATWTGAGIGRNQLTMARWSLELGGHCRTGLEDNVRMDKNTLA
PSNSALVRQVAELCEEFGRPVATAAQAREILNLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory