SitesBLAST
Comparing BPHYT_RS31620 FitnessBrowser__BFirm:BPHYT_RS31620 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
35% identity, 93% coverage: 15:362/373 of query aligns to 2:347/357 of 3ck5A
- active site: T19 (≠ A32), T50 (≠ S61), G137 (≠ S144), K164 (= K172), K166 (= K174), D195 (= D201), N197 (= N203), I220 (≠ F226), E221 (= E227), I243 (= I251), G246 (= G254), E247 (= E255), E268 (≠ Q276), D270 (= D278), H297 (= H305), G298 (≠ C306), V299 (≠ A307), Y315 (≠ W326), E317 (≠ H328)
- binding magnesium ion: D195 (= D201), E221 (= E227), E247 (= E255)
Q9RKF7 3,6-anhydro-alpha-L-galactonate cycloisomerase; AHGA cycloisomerase; EC 5.5.1.25 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
35% identity, 93% coverage: 15:362/373 of query aligns to 2:350/361 of Q9RKF7
- D195 (= D201) binding
- E221 (= E227) binding
- E247 (= E255) binding
3bjsB Crystal structure of a member of enolase superfamily from polaromonas sp. Js666
31% identity, 91% coverage: 22:362/373 of query aligns to 12:358/376 of 3bjsB
- active site: V18 (≠ D28), P49 (≠ S61), S52 (= S64), L93 (≠ R101), G136 (≠ S144), K164 (= K172), R166 (≠ K174), D194 (= D201), N196 (= N203), E220 (= E227), G246 (= G254), E247 (= E255), N248 (≠ Y256), Q268 (= Q276), D270 (= D278), H297 (= H305), S298 (≠ C306), S299 (≠ A307), E322 (= E325), C324 (≠ F327), K327 (≠ H330)
- binding magnesium ion: D194 (= D201), E220 (= E227), E247 (= E255)
5xd8B Crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase (see paper)
27% identity, 97% coverage: 12:373/373 of query aligns to 2:363/367 of 5xd8B
- active site: S22 (≠ T27), T53 (≠ G57), G140 (≠ S144), K167 (= K172), K169 (= K174), D198 (= D201), N200 (= N203), E224 (= E227), G249 (= G254), E250 (= E255), Q271 (= Q276), D273 (= D278), H300 (= H305), G301 (≠ C306), M302 (≠ A307), W317 (= W326), E319 (≠ H328), P324 (≠ R332)
- binding magnesium ion: D198 (= D201), E224 (= E227), E250 (= E255)
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
33% identity, 94% coverage: 15:365/373 of query aligns to 4:359/373 of 3cb3A
- active site: K24 (vs. gap), S57 (= S61), T143 (vs. gap), K171 (= K172), K173 (= K174), D202 (= D201), N204 (= N203), E228 (= E227), G253 (= G254), E254 (= E255), M275 (≠ Q276), D277 (= D278), H304 (= H305), F305 (≠ C306), A306 (= A307), E324 (≠ R322)
- binding l-glucaric acid: K171 (= K172), K173 (= K174), D202 (= D201), E254 (= E255), H304 (= H305)
- binding magnesium ion: D202 (= D201), E228 (= E227), A243 (≠ G248), F246 (vs. gap), E254 (= E255)
2pp1A Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate (see paper)
32% identity, 80% coverage: 43:340/373 of query aligns to 59:363/395 of 2pp1A
- active site: S78 (= S61), K192 (= K172), K194 (= K174), D223 (= D201), N225 (= N203), E249 (= E227), G274 (= G254), E275 (= E255), D298 (= D278), H325 (= H305), E345 (≠ R322)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: K79 (≠ D62), F168 (= F147), K194 (= K174), E275 (= E255), H325 (= H305), E345 (≠ R322)
- binding magnesium ion: D223 (= D201), E249 (= E227), E275 (= E255)
Sites not aligning to the query:
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 80% coverage: 43:340/373 of query aligns to 62:366/398 of Q8ZL58
- KR 82:83 (≠ DK 62:63) binding
- K195 (= K172) binding
- K197 (= K174) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D201) binding
- N228 (= N203) binding
- E252 (= E227) binding
- E278 (= E255) binding
- H328 (= H305) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- E348 (≠ R322) binding
Sites not aligning to the query:
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
34% identity, 87% coverage: 43:365/373 of query aligns to 27:348/363 of 2og9A
- active site: S46 (= S61), T132 (vs. gap), K160 (= K172), K162 (= K174), D191 (= D201), N193 (= N203), E217 (= E227), G242 (= G254), E243 (= E255), M264 (≠ Q276), D266 (= D278), H293 (= H305), F294 (≠ C306), A295 (= A307), E313 (≠ R322)
- binding calcium ion: A232 (≠ G248), F235 (vs. gap)
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
32% identity, 80% coverage: 43:340/373 of query aligns to 59:363/395 of 2pp3A
- active site: S78 (= S61), K192 (= K172), A194 (≠ K174), D223 (= D201), N225 (= N203), E249 (= E227), G274 (= G254), E275 (= E255), D298 (= D278), H325 (= H305), E345 (≠ R322)
- binding l-glucaric acid: K79 (≠ D62), K192 (= K172), D223 (= D201), N225 (= N203), E275 (= E255), H325 (= H305), E345 (≠ R322), F347 (≠ Q324)
- binding magnesium ion: D223 (= D201), E249 (= E227), E275 (= E255)
Sites not aligning to the query:
3stpA Crystal structure of a putative galactonate dehydratase
29% identity, 92% coverage: 31:372/373 of query aligns to 35:388/390 of 3stpA
- active site: L66 (≠ S61), S69 (= S64), S151 (= S144), K177 (= K172), R179 (≠ K174), P189 (= P183), E214 (≠ D201), Y216 (≠ N203), E240 (= E227), G265 (= G254), E266 (= E255), H267 (≠ Y256), Q287 (= Q276), D289 (= D278), I311 (≠ V300), H316 (= H305), E336 (= E325), F341 (vs. gap)
- binding magnesium ion: E214 (≠ D201), E240 (= E227), E266 (= E255)
3ozmD Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
31% identity, 86% coverage: 43:362/373 of query aligns to 34:364/381 of 3ozmD
- active site: G53 (≠ S61), D56 (≠ S64), S143 (= S144), K170 (= K172), K172 (= K174), D200 (= D201), N202 (= N203), E226 (= E227), G252 (= G254), E253 (= E255), N254 (≠ Y256), Q274 (= Q276), D276 (= D278), H303 (= H305), T304 (vs. gap), F305 (vs. gap), E328 (= E325), I331 (≠ H328), H333 (= H330)
- binding L-arabinaric acid: K172 (= K174), D200 (= D201), N202 (= N203), E253 (= E255), H303 (= H305), F305 (vs. gap), E328 (= E325)
- binding magnesium ion: D200 (= D201), E226 (= E227), E253 (= E255)
Sites not aligning to the query:
3ozmA Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
31% identity, 86% coverage: 43:362/373 of query aligns to 34:364/386 of 3ozmA
- active site: G53 (≠ S61), D56 (≠ S64), S143 (= S144), K170 (= K172), K172 (= K174), D200 (= D201), N202 (= N203), E226 (= E227), G252 (= G254), E253 (= E255), N254 (≠ Y256), Q274 (= Q276), D276 (= D278), H303 (= H305), T304 (vs. gap), F305 (vs. gap), E328 (= E325), I331 (≠ H328), H333 (= H330)
- binding D-xylaric acid: Y146 (≠ F147), K170 (= K172), K172 (= K174), D200 (= D201), N202 (= N203), E253 (= E255), H303 (= H305), F305 (vs. gap), E328 (= E325)
- binding magnesium ion: D200 (= D201), E226 (= E227), E253 (= E255)
Sites not aligning to the query:
4h19A Crystal structure of an enolase (mandelate racemase subgroup, target efi-502087) from agrobacterium tumefaciens, with bound mg and d- ribonohydroxamate, ordered loop
31% identity, 84% coverage: 48:361/373 of query aligns to 43:372/372 of 4h19A
- active site: T51 (≠ I56), T143 (≠ S144), K172 (= K172), K174 (= K174), D203 (= D201), N205 (= N203), E229 (= E227), G254 (= G254), E255 (= E255), Q276 (= Q276), D278 (= D278), H305 (= H305), A306 (≠ C306), G307 (≠ A307), E327 (≠ R322)
- binding (2R,3R,4R)-N,2,3,4,5-pentakis(oxidanyl)pentanamide: H52 (vs. gap), K172 (= K172), K174 (= K174), D203 (= D201), N205 (= N203), E229 (= E227), E255 (= E255), H305 (= H305), E327 (≠ R322)
- binding calcium ion: D268 (≠ A268), H298 (≠ F298)
- binding magnesium ion: D203 (= D201), E229 (= E227), E255 (= E255)
Sites not aligning to the query:
3sqsA Crystal structure of a putative mandelate racemase/muconate lactonizing protein from dinoroseobacter shibae dfl 12
28% identity, 93% coverage: 27:372/373 of query aligns to 27:384/386 of 3sqsA
- active site: L62 (≠ S61), N65 (≠ S64), S147 (= S144), K173 (= K172), R175 (≠ K174), G177 (= G176), G179 (≠ D178), K181 (≠ Q180), A185 (≠ G184), E210 (≠ D201), Y212 (≠ N203), E236 (= E227), G261 (= G254), E262 (= E255), H263 (≠ Y256), Q283 (= Q276), D285 (= D278), I307 (≠ V300), H312 (= H305), G314 (≠ A307), E332 (= E325), F337 (vs. gap)
- binding magnesium ion: E210 (≠ D201), E236 (= E227), E262 (= E255), Y347 (≠ S335), F350 (= F338), D351 (= D339)
3op2A Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate
30% identity, 86% coverage: 43:362/373 of query aligns to 34:359/375 of 3op2A
- active site: G53 (≠ S61), D56 (≠ S64), S138 (= S144), K165 (= K172), K167 (= K174), D195 (= D201), N197 (= N203), E221 (= E227), G247 (= G254), E248 (= E255), N249 (≠ Y256), Q269 (= Q276), D271 (= D278), H298 (= H305), T299 (vs. gap), F300 (vs. gap), E323 (= E325), I326 (≠ H328), H328 (= H330)
- binding 2-oxoglutaric acid: K165 (= K172), K167 (= K174), D195 (= D201), E248 (= E255), H298 (= H305), E323 (= E325)
- binding magnesium ion: D195 (= D201), E221 (= E227), E248 (= E255)
Sites not aligning to the query:
3toyA Crystal structure of enolase brado_4202 (target efi-501651) from bradyrhizobium sp. Ors278 with calcium and acetate bound
29% identity, 98% coverage: 7:372/373 of query aligns to 9:358/359 of 3toyA
- active site: L21 (≠ R19), A52 (≠ S61), R55 (vs. gap), Q96 (≠ S102), S138 (= S144), K164 (= K172), K166 (= K174), D195 (= D201), N197 (= N203), E221 (= E227), G246 (= G254), E247 (= E255), N248 (≠ Y256), M268 (≠ Q276), D270 (= D278), I292 (≠ V300), H297 (= H305), I298 (≠ C306), L299 (≠ A307), H314 (≠ R322), E317 (= E325)
- binding calcium ion: D195 (= D201), E221 (= E227), R236 (= R242), S239 (≠ A245), E247 (= E255)
3tteA Crystal structure of enolase brado_4202 (target efi-501651) from bradyrhizobium complexed with magnesium and mandelic acid
29% identity, 98% coverage: 7:372/373 of query aligns to 11:360/361 of 3tteA
- active site: L23 (≠ R19), A54 (≠ S61), R57 (vs. gap), Q98 (≠ S102), S140 (= S144), K166 (= K172), K168 (= K174), D197 (= D201), N199 (= N203), E223 (= E227), G248 (= G254), E249 (= E255), N250 (≠ Y256), M270 (≠ Q276), D272 (= D278), I294 (≠ V300), H299 (= H305), I300 (≠ C306), L301 (≠ A307), H316 (≠ R322), E319 (= E325)
- binding magnesium ion: D197 (= D201), E223 (= E227), E249 (= E255)
- binding (s)-mandelic acid: K166 (= K172), D197 (= D201), N199 (= N203), E223 (= E227), E249 (= E255), H299 (= H305), E319 (= E325)
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
27% identity, 83% coverage: 52:362/373 of query aligns to 31:340/351 of 5olcC
- active site: K148 (= K172), K150 (= K174), D178 (= D201), N180 (= N203), E204 (= E227), G229 (= G254), E230 (= E255), D253 (= D278), H280 (= H305), E304 (vs. gap), E309 (≠ Q324)
- binding magnesium ion: D178 (= D201), E204 (= E227), E230 (= E255)
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
30% identity, 92% coverage: 23:367/373 of query aligns to 13:369/378 of 4hpnA
- active site: F19 (≠ A29), G50 (≠ S61), R53 (≠ S64), T134 (≠ S144), K164 (= K172), K166 (= K174), D194 (= D201), N196 (= N203), E220 (= E227), G245 (= G254), E246 (= E255), T247 (≠ Y256), Q267 (= Q276), D269 (= D278), H296 (= H305), V297 (≠ C306), W298 (vs. gap), R320 (= R322), E329 (= E325), F330 (≠ W326), H334 (= H330)
- binding calcium ion: D194 (= D201), D209 (≠ Q216), E220 (= E227), G237 (≠ H244), E246 (= E255)
3no1A Crystal structure of mandelate racemase/muconate lactonizing enzyme from a marine actinobacterium in complex with magnesium
27% identity, 93% coverage: 25:372/373 of query aligns to 9:355/355 of 3no1A
- active site: D39 (≠ S61), I127 (≠ S144), K154 (= K172), K156 (= K174), I184 (≠ V200), D185 (= D201), A186 (= A202), N187 (= N203), E211 (= E227), G237 (= G254), Q238 (≠ E255), N259 (≠ Q276), D261 (= D278), H288 (= H305), E289 (≠ C306), E290 (≠ A307), E308 (= E325), D313 (= D329)
- binding magnesium ion: D185 (= D201), E211 (= E227), Q238 (≠ E255)
Query Sequence
>BPHYT_RS31620 FitnessBrowser__BFirm:BPHYT_RS31620
MTDRTATHRAAQAPVNRLRASAYRIPTDAPEADGTFSWKATTLVVVEVEAAGQTGIGYTY
SDKSLVTLVHDALGECVLHSDVWDIRAIWQRMQRQVRNLGRSGLAATAISATDCALWDLK
AKLLGVPLVRLLGAARESVPLYGSGGFTTYSDKQMREQLAGWVERDGCRWVKIKIGTDPQ
KDPGRVETARAAIGDAGLFVDANGAFTPQQALHWAQRFAQQRVEWFEEPVSSDDPAGLHF
VRGHAPAGMEIAAGEYGYTLDDFRQLLAAQSVDVLQADVSRCGGITGFMQAADLCDAFHV
PLSAHCAPALHLHVACAVPRLRHQEWFHDHVRIESMLFDGAPQAIDGTIAPDLTRPGCGL
ELKSRDAAAYQVQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory