SitesBLAST
Comparing BPHYT_RS31650 FitnessBrowser__BFirm:BPHYT_RS31650 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
28% identity, 53% coverage: 1:188/355 of query aligns to 47:231/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ I30), G75 (= G32), S76 (≠ G33), G77 (≠ N34), T78 (≠ S35), G79 (≠ A37), L80 (≠ F38), A83 (≠ R41), C84 (≠ P42), P137 (= P92), G138 (≠ P93), E139 (= E94), A142 (= A99), T143 (= T100), G146 (= G103), N147 (≠ M104), S149 (≠ A106), T150 (≠ A107), A152 (≠ L109), G153 (≠ A110), E203 (≠ F160), G204 (= G161), I209 (= I166)
Sites not aligning to the query:
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 46% coverage: 12:176/355 of query aligns to 50:214/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
6gouA Development of alkyl glycerone phosphate synthase inhibitors: complex with inhibitor 2i (see paper)
30% identity, 44% coverage: 48:202/355 of query aligns to 178:334/554 of 6gouA
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: D223 (≠ P93)
- binding flavin-adenine dinucleotide: P222 (= P92), D223 (≠ P93), S224 (≠ E94), S228 (≠ A99), T229 (= T100), G232 (= G103), W233 (≠ M104), S235 (≠ A106), T236 (≠ A107), A238 (≠ L109), S239 (≠ A110), E288 (≠ F160), V293 (≠ L165), I294 (= I166)
Sites not aligning to the query:
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: 411, 421, 422, 423, 474, 476, 478
- binding flavin-adenine dinucleotide: 16, 154, 155, 156, 157, 158, 159, 160, 161, 164, 512
P97275 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Cavia porcellus (Guinea pig) (see 4 papers)
30% identity, 44% coverage: 48:202/355 of query aligns to 258:414/658 of P97275
- H300 (≠ C90) mutation to A: Loss of activity.
- 303:309 (vs. 93:100, 13% identical) binding
- T309 (= T100) mutation to I: Impaired FAD binding and protein stability. Loss of activity.
- TRAS 316:319 (≠ AGLA 107:110) binding
- S367 (= S159) mutation to A: Strongly reduced activity.
- 368:374 (vs. 160:166, 57% identical) binding
Sites not aligning to the query:
- 1:58 modified: transit peptide, Peroxisome
- 234:240 binding
- 419 Important for enzyme activity; R→H: Loss of activity.; R→K: Strongly reduced activity.
- 469 L→P: Impaired FAD binding and protein stability. Loss of activity.
- 515 binding ; R→L: Impaired FAD binding and protein stability. Loss of activity.
- 576 C→A: No effect on activity.
- 578 active site, Proton donor/acceptor; Y→F: Loss of activity.
- 615 H→A: Loss of activity.
- 615:617 Important for enzyme activity
- 616 H→A: Loss of activity.
- 617 H→A: Loss of activity.
- 654:658 Important for enzyme activity
5adzC Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
30% identity, 44% coverage: 48:202/355 of query aligns to 178:334/557 of 5adzC
- binding flavin-adenine dinucleotide: P222 (= P92), D223 (≠ P93), S224 (≠ E94), S228 (≠ A99), T229 (= T100), G232 (= G103), W233 (≠ M104), S235 (≠ A106), T236 (≠ A107), A238 (≠ L109), S239 (≠ A110), E288 (≠ F160), G289 (= G161), I294 (= I166)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D223 (≠ P93)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 154, 155, 156, 157, 158, 159, 160, 515
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): 410, 414, 424, 425, 426, 477, 515, 516
4bc9B Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
30% identity, 44% coverage: 48:202/355 of query aligns to 164:320/542 of 4bc9B
- binding propanenitrile: D209 (≠ P93)
- binding flavin-adenine dinucleotide: P208 (= P92), D209 (≠ P93), S210 (≠ E94), S214 (≠ A99), T215 (= T100), G218 (= G103), W219 (≠ M104), S221 (≠ A106), T222 (≠ A107), A224 (≠ L109), S225 (≠ A110), E274 (≠ F160), G275 (= G161), I280 (= I166)
Sites not aligning to the query:
- binding propanenitrile: 462, 501
- binding flavin-adenine dinucleotide: 140, 142, 143, 144, 145, 146, 147, 150, 151, 500
4bc7B Mammalian alkyldihydroxyacetonephosphate synthase: arg419his mutant (see paper)
30% identity, 44% coverage: 48:202/355 of query aligns to 164:320/543 of 4bc7B
- binding flavin-adenine dinucleotide: P208 (= P92), D209 (≠ P93), S210 (≠ E94), S214 (≠ A99), T215 (= T100), G218 (= G103), S221 (≠ A106), T222 (≠ A107), A224 (≠ L109), S225 (≠ A110), E274 (≠ F160), G275 (= G161), I280 (= I166)
Sites not aligning to the query:
- binding 1-dodecanol: 410, 412
- binding flavin-adenine dinucleotide: 16, 140, 142, 143, 144, 145, 146, 147, 150, 151, 501
4bc9A Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
30% identity, 44% coverage: 48:202/355 of query aligns to 169:325/555 of 4bc9A
- binding propanenitrile: D214 (≠ P93)
- binding flavin-adenine dinucleotide: P213 (= P92), D214 (≠ P93), S215 (≠ E94), S219 (≠ A99), T220 (= T100), G223 (= G103), W224 (≠ M104), S226 (≠ A106), T227 (≠ A107), A229 (≠ L109), S230 (≠ A110), E279 (≠ F160), V284 (≠ L165), I285 (= I166)
Sites not aligning to the query:
- binding propanenitrile: 475, 513, 514
- binding flavin-adenine dinucleotide: 145, 146, 147, 148, 149, 150, 151, 152, 155, 156, 513
5adzA Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
30% identity, 44% coverage: 48:202/355 of query aligns to 166:322/566 of 5adzA
- binding flavin-adenine dinucleotide: P210 (= P92), D211 (≠ P93), S212 (≠ E94), S216 (≠ A99), T217 (= T100), G220 (= G103), W221 (≠ M104), S223 (≠ A106), T224 (≠ A107), A226 (≠ L109), S227 (≠ A110), E276 (≠ F160), G277 (= G161), V281 (≠ L165), I282 (= I166)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D211 (≠ P93)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 142, 143, 144, 145, 146, 147, 148, 152, 524
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): 423, 433, 434, 435, 486, 488, 489, 524, 525
5ae2A Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
30% identity, 44% coverage: 48:202/355 of query aligns to 169:325/561 of 5ae2A
- binding flavin-adenine dinucleotide: P213 (= P92), D214 (≠ P93), S215 (≠ E94), S219 (≠ A99), T220 (= T100), G223 (= G103), W224 (≠ M104), S226 (≠ A106), T227 (≠ A107), A229 (≠ L109), S230 (≠ A110), E279 (≠ F160), V284 (≠ L165), I285 (= I166)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 145, 146, 147, 148, 149, 150, 151, 155, 156, 519
- binding 3-(2-fluorophenyl)-2-methyl-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)acrylamide: 415, 418, 428, 429, 430, 481, 483, 519
5ae3A Ether lipid-generating enzyme agps in complex with antimycin a (see paper)
30% identity, 44% coverage: 48:202/355 of query aligns to 164:320/539 of 5ae3A
- binding flavin-adenine dinucleotide: P208 (= P92), D209 (≠ P93), S210 (≠ E94), S214 (≠ A99), T215 (= T100), G218 (= G103), W219 (≠ M104), S221 (≠ A106), T222 (≠ A107), A224 (≠ L109), S225 (≠ A110), E274 (≠ F160), V279 (≠ L165), I280 (= I166)
Sites not aligning to the query:
- binding [(2R,3S,6S,7R,8R)-3-[(3-formamido-2-oxidanyl-phenyl)carbonylamino]-8-hexyl-2,6-dimethyl-4,9-bis(oxidanylidene)-1,5-dioxonan-7-yl] 3-methylbutanoate: 45, 49, 53, 325, 327, 331, 334, 349, 386, 393, 396, 400, 447, 461
- binding flavin-adenine dinucleotide: 140, 141, 142, 143, 144, 145, 146, 147, 151, 497
5ae2B Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
30% identity, 44% coverage: 48:202/355 of query aligns to 164:320/542 of 5ae2B
- binding flavin-adenine dinucleotide: P208 (= P92), D209 (≠ P93), S210 (≠ E94), S214 (≠ A99), T215 (= T100), G218 (= G103), W219 (≠ M104), S221 (≠ A106), T222 (≠ A107), A224 (≠ L109), S225 (≠ A110), E274 (≠ F160), G275 (= G161), V279 (≠ L165), I280 (= I166)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 140, 142, 143, 144, 145, 146, 150, 151, 500
- binding 3-(2-fluorophenyl)-2-methyl-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)acrylamide: 399, 409, 410, 411, 462, 464, 466, 500, 501
5ae1B Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
30% identity, 44% coverage: 48:202/355 of query aligns to 164:320/539 of 5ae1B
- binding flavin-adenine dinucleotide: P208 (= P92), D209 (≠ P93), S210 (≠ E94), S214 (≠ A99), T215 (= T100), G218 (= G103), W219 (≠ M104), S221 (≠ A106), T222 (≠ A107), A224 (≠ L109), S225 (≠ A110), E274 (≠ F160), V279 (≠ L165), I280 (= I166)
Sites not aligning to the query:
- binding (3-(2-fluorophenyl)-n-(1-(2-oxo-2,3-dihydro-1h-benzo[d]imidazol-5-yl)ethyl)butanamide): 392, 396, 406, 407, 408, 459, 497
- binding flavin-adenine dinucleotide: 16, 140, 141, 142, 143, 144, 145, 146, 150, 151, 497, 535
5ae1A Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
30% identity, 44% coverage: 48:202/355 of query aligns to 163:319/560 of 5ae1A
- binding flavin-adenine dinucleotide: P207 (= P92), D208 (≠ P93), S209 (≠ E94), S213 (≠ A99), T214 (= T100), G216 (= G102), G217 (= G103), W218 (≠ M104), S220 (≠ A106), T221 (≠ A107), A223 (≠ L109), S224 (≠ A110), E273 (≠ F160), G274 (= G161), V278 (≠ L165), I279 (= I166)
Sites not aligning to the query:
- binding (3-(2-fluorophenyl)-n-(1-(2-oxo-2,3-dihydro-1h-benzo[d]imidazol-5-yl)ethyl)butanamide): 416, 417, 427, 428, 429, 480, 518
- binding flavin-adenine dinucleotide: 139, 140, 141, 142, 143, 144, 145, 146, 149, 150, 518
O00116 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Aging-associated gene 5 protein; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Homo sapiens (Human) (see 2 papers)
30% identity, 44% coverage: 48:202/355 of query aligns to 258:414/658 of O00116
Sites not aligning to the query:
- 182 R → Q: in RCDP3; severely reduced protein levels
- 419 Important for enzyme activity; R → H: in RCDP3; loss of enzyme activity; dbSNP:rs121434411
- 471 E → K: in RCDP3; severely reduced protein levels
- 568 T → M: in RCDP3; does not affect protein levels; dbSNP:rs387907214
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
32% identity, 35% coverage: 56:181/355 of query aligns to 103:227/466 of 6lpxA
- binding flavin-adenine dinucleotide: L139 (≠ P92), G140 (≠ P93), A141 (≠ E94), C145 (≠ A99), G149 (= G103), N150 (≠ M104), A152 (= A106), T153 (≠ A107), G157 (= G111), G207 (= G161), I212 (= I166)
Sites not aligning to the query:
- binding 2-oxoglutaric acid: 333, 337, 348, 379, 381, 388, 423
- binding flavin-adenine dinucleotide: 39, 75, 76, 77, 78, 79, 80, 81, 82, 85, 86, 422, 459
- binding zinc ion: 381, 388, 422
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
32% identity, 35% coverage: 56:181/355 of query aligns to 103:227/466 of 6lpuA
- binding flavin-adenine dinucleotide: L139 (≠ P92), G140 (≠ P93), A141 (≠ E94), C145 (≠ A99), H146 (≠ T100), G148 (= G102), G149 (= G103), N150 (≠ M104), A152 (= A106), T153 (≠ A107), A155 (≠ L109), E206 (≠ F160), G207 (= G161), I211 (≠ L165), I212 (= I166)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 75, 77, 78, 79, 80, 81, 85, 86, 422, 459
- binding (2s)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 423
- binding zinc ion: 381, 388, 422
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
32% identity, 35% coverage: 56:181/355 of query aligns to 103:227/466 of 6lpqA
- binding flavin-adenine dinucleotide: L139 (≠ P92), G140 (≠ P93), A141 (≠ E94), C145 (≠ A99), H146 (≠ T100), G149 (= G103), N150 (≠ M104), A152 (= A106), T153 (≠ A107), A155 (≠ L109), G157 (= G111), E206 (≠ F160), G207 (= G161), I211 (≠ L165), I212 (= I166)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 75, 77, 78, 79, 80, 81, 85, 86, 422, 459
- binding d-malate: 82, 333, 337, 348, 379, 381, 388, 422, 423
- binding zinc ion: 381, 388, 422
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
32% identity, 35% coverage: 56:181/355 of query aligns to 103:227/466 of 6lppA
- binding flavin-adenine dinucleotide: L139 (≠ P92), G140 (≠ P93), A141 (≠ E94), C145 (≠ A99), G149 (= G103), N150 (≠ M104), A152 (= A106), T153 (≠ A107), A155 (≠ L109), G157 (= G111), G207 (= G161), I212 (= I166)
Sites not aligning to the query:
- binding (2R)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 390, 423
- binding flavin-adenine dinucleotide: 39, 75, 77, 78, 79, 80, 81, 82, 85, 86, 422, 423
- binding zinc ion: 381, 388, 422
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
32% identity, 35% coverage: 56:181/355 of query aligns to 104:228/467 of 6lpnB
- binding flavin-adenine dinucleotide: L140 (≠ P92), A142 (≠ E94), C146 (≠ A99), H147 (≠ T100), G150 (= G103), N151 (≠ M104), A153 (= A106), T154 (≠ A107), G208 (= G161), I212 (≠ L165), I213 (= I166)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 40, 76, 78, 79, 80, 81, 82, 83, 86, 87, 423, 460
Query Sequence
>BPHYT_RS31650 FitnessBrowser__BFirm:BPHYT_RS31650
MLIEAVSTDDSERLVAEVSQAQSHGTPLSIRGGNSKAFLGRPVQGTPIDTRSHRGVVSYD
PTELVITARAGTPVAELAAVLDAAGQMLPCEPPEFDGTATVGGMVAAGLAGPRRPWSGSV
RDFVLGCRVITGRALHLRFGGEVMKNVAGYDVSRLLAGSFGCLGLITEVSFKVLPKPRAL
GSLALDLEAGEALRELSAWRPAGLPISGAAHVDGRLHVRLEGGTGSVASAMDRIGGTELD
PRFWDALREHRLAFFDDPRPLWRLSLPNASPLTPLPGDTLLDWAGAQRWLKSEAPATTIR
QIAHAAGGHATCFTPRVDAERFSPLPPTLLRFHQRLKQQLDPRGLFNPGRLYVDL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory