Comparing BPHYT_RS31655 FitnessBrowser__BFirm:BPHYT_RS31655 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
5odqB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. (see paper)
22% identity, 54% coverage: 169:390/409 of query aligns to 2:239/291 of 5odqB
5odhH Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 3.5 minutes (see paper)
22% identity, 54% coverage: 169:390/409 of query aligns to 2:239/291 of 5odhH
Sites not aligning to the query:
5odhB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 3.5 minutes (see paper)
22% identity, 54% coverage: 169:390/409 of query aligns to 2:239/291 of 5odhB
5odcB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus at 2.3 a resolution (see paper)
22% identity, 54% coverage: 169:390/409 of query aligns to 2:239/291 of 5odcB
>BPHYT_RS31655 FitnessBrowser__BFirm:BPHYT_RS31655
MQTNLSDAAKTLSRADEAEQILRSCVHCGFCNATCPTYQLLGNELDGPRGRIYLIKQMLE
GEPVTQKTQMHLDRCLSCRNCETTCPSGVTYHALLDIGRAELERRIVRPALERLQRESLR
HVIPHRAVFGALLKTGQAMRPFLPTALGRKIPGRSARAKTRPEPRHSRKMLMLEGCVQRA
LSPNTNAAAARVLDRLGISIVNAERADCCGATDYHLNAQEAGLARARRNIDAWWPAIQAG
AEAIVQTASGCGAFVKEYGHLLRDDLRYASKAQRVSELARDIVEVLANEPIQPIQTNLSG
TPQQKIAFHCPCTLQHAQKLGGAVEAVLQRLGFDLSAVPDAHLCCGSAGTYSITQPELAK
KLRSNKLDALESGKPDLIVTANIGCQTHLDGAGRTPVRHWIELVEASLP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory