Comparing BPHYT_RS31925 FitnessBrowser__BFirm:BPHYT_RS31925 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
51% identity, 96% coverage: 10:243/243 of query aligns to 6:239/240 of 1ji0A
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 92% coverage: 20:242/243 of query aligns to 14:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 92% coverage: 20:242/243 of query aligns to 14:253/254 of 1g6hA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 96% coverage: 10:242/243 of query aligns to 2:235/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
31% identity, 95% coverage: 11:242/243 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
31% identity, 95% coverage: 11:242/243 of query aligns to 3:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
31% identity, 95% coverage: 11:242/243 of query aligns to 3:235/235 of 6mhzA
6mbnA Lptb e163q in complex with atp (see paper)
30% identity, 97% coverage: 8:242/243 of query aligns to 1:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
30% identity, 95% coverage: 11:241/243 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
30% identity, 95% coverage: 11:241/243 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
30% identity, 95% coverage: 11:240/243 of query aligns to 3:233/233 of 6b8bA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 94% coverage: 2:230/243 of query aligns to 9:235/378 of P69874
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 91% coverage: 10:230/243 of query aligns to 2:223/241 of 4u00A
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
30% identity, 88% coverage: 9:222/243 of query aligns to 2:218/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
30% identity, 88% coverage: 9:222/243 of query aligns to 2:218/230 of 6z4wA
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 86% coverage: 22:230/243 of query aligns to 16:222/393 of P9WQI3
3d31A Modbc from methanosarcina acetivorans (see paper)
27% identity, 91% coverage: 10:230/243 of query aligns to 1:215/348 of 3d31A
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 95% coverage: 11:242/243 of query aligns to 4:235/369 of P19566
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 88% coverage: 20:234/243 of query aligns to 11:231/240 of 4ymuJ
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
30% identity, 87% coverage: 19:230/243 of query aligns to 15:230/375 of 2d62A
>BPHYT_RS31925 FitnessBrowser__BFirm:BPHYT_RS31925
MKTDTDITTLLEVRGLQVRYGGVTAVDGIDLDLPRGSVVALIGSNGAGKTSVMNAVMNLK
AGCAGTRRFDGEDIASLRTDQIVERGVALVPEGRRLFPHMTVRENLAMGAYLRRNRDGIQ
RDMERVLDVFPALTAKLRQPAMSLSGGQQQMVAIGRALMSSPRLLLLDEPTIGLAPAVVQ
LIGDTIQLINREGVNVLLVEQNASVALNLSSYAYVIERGSVVMHGLSAELKNDRRVHAAY
LGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory