Comparing BPHYT_RS32475 FitnessBrowser__BFirm:BPHYT_RS32475 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
Q3LXA3 Triokinase/FMN cyclase; Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing); EC 2.7.1.28; EC 2.7.1.29; EC 4.6.1.15 from Homo sapiens (Human) (see 4 papers)
47% identity, 97% coverage: 2:550/567 of query aligns to 4:558/575 of Q3LXA3
P45510 Dihydroxyacetone kinase; DHA kinase; Glycerone kinase; EC 2.7.1.29 from Citrobacter freundii (see 2 papers)
39% identity, 99% coverage: 2:564/567 of query aligns to 3:549/552 of P45510
Sites not aligning to the query:
P76015 PEP-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK; EC 2.7.1.121 from Escherichia coli (strain K12) (see 3 papers)
46% identity, 59% coverage: 1:335/567 of query aligns to 1:353/356 of P76015
1un9A Crystal structure of the dihydroxyacetone kinase from c. Freundii in complex with amp-pnp and mg2+ (see paper)
39% identity, 99% coverage: 2:564/567 of query aligns to 3:536/537 of 1un9A
Q9CIV8 PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK; EC 2.7.1.121 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
42% identity, 58% coverage: 2:331/567 of query aligns to 4:331/332 of Q9CIV8
3ct4A Structure of dha-kinase subunit dhak from l. Lactis (see paper)
40% identity, 58% coverage: 2:331/567 of query aligns to 1:318/318 of 3ct4A
1uodA Crystal structure of the dihydroxyacetone kinase from e. Coli in complex with dihydroxyacetone-phosphate (see paper)
43% identity, 57% coverage: 11:335/567 of query aligns to 2:333/336 of 1uodA
1uoeA Crystal structure of the dihydroxyacetone kinase from e. Coli in complex with glyceraldehyde (see paper)
43% identity, 57% coverage: 11:335/567 of query aligns to 2:333/336 of 1uoeA
3pnqD Crystal structure of e.Coli dha kinase dhak (h56n) complex with dha (see paper)
42% identity, 57% coverage: 11:335/567 of query aligns to 2:331/334 of 3pnqD
4lrzA Crystal structure of the e.Coli dhar(n)-dhal complex (see paper)
34% identity, 38% coverage: 355:567/567 of query aligns to 1:209/211 of 4lrzA
P76014 PEP-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 35% coverage: 372:567/567 of query aligns to 15:208/210 of P76014
Q9CIV7 PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
29% identity, 34% coverage: 377:566/567 of query aligns to 20:192/192 of Q9CIV7
3cr3A Structure of a transient complex between dha-kinase subunits dham and dhal from lactococcus lactis (see paper)
29% identity, 34% coverage: 377:566/567 of query aligns to 20:192/192 of 3cr3A
>BPHYT_RS32475 FitnessBrowser__BFirm:BPHYT_RS32475
MKKLINEVSAVVPDMLDGLAALNPNLSLLQGGTIVVRADAEAAAARGEVALISGGGSGHE
PAHGGYVGSGMLSAAVAGEVFTSPSTDAVLDAIRAVAGAAGALLIVKNYTGDRFNFGLAA
EIARAEGIPTEMVIVADDVALTASGDHAGRRGLAGTVLIHKIAGAAAAAGRPLGEVAQIA
RDVAASLGTMGVALTACTVPAAGKPGFELADGEIEWGLGIHGEPGVERGALEPADAIVEK
LLAKIVGDLSLQTGERVALLVNNLGGTPSSELSIVAGSALRYLAKRGIEVERAWAGTFLS
ALEMAGVSLTLLRVDDERLAWLDAATHTSAWPALSGRVARVSVRPAPAEPERASGATLSR
EATLRRVIEAVCACLLEAEPTLTDMDQRVGDGDLGISLSRGARAILHELDDYPAETTPAA
VLRSMSATLRRVVGGTSGPLYAVMLVRAAVALEQSGGSTPKEWAVAFSAGVDGLMELGGA
HPGDRTMVDALKPAADALQSALARQDALDAALQAAVDAVSAGASQTASMHPRRGRSSYVG
DRALGHVDPGAHAVALWLAAIREALAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory