SitesBLAST
Comparing BPHYT_RS32805 FitnessBrowser__BFirm:BPHYT_RS32805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
30% identity, 94% coverage: 47:756/756 of query aligns to 18:721/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (= M67), G39 (= G68), Q40 (= Q69), H41 (≠ G70), V42 (≠ I71), A45 (≠ G74), G79 (= G142), G80 (= G143), S81 (= S144), S83 (= S146), V84 (≠ I147), G374 (≠ A429), F375 (= F430), L379 (= L434), L499 (≠ W549), R500 (= R550), V624 (= V659), D625 (≠ N660), Q632 (= Q667), T687 (≠ Q722), G688 (= G723), L689 (≠ V724), G690 (= G725), E691 (= E726)
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
25% identity, 47% coverage: 216:573/756 of query aligns to 538:908/1291 of 2e3tA
- active site: Q740 (= Q399), E775 (≠ R433), R853 (≠ P511), H857 (≠ A523), R885 (= R550)
- binding bicarbonate ion: R812 (= R470), H813 (≠ P471), I850 (≠ Y508), T882 (≠ F548), A883 (vs. gap), F887 (≠ V552), G888 (= G553), Q891 (≠ H556)
- binding calcium ion: E713 (≠ A374), H714 (= H375), Y716 (≠ A377), T809 (≠ D467), G810 (≠ F468), G840 (≠ A498), T843 (≠ P501), E844 (= E502), S847 (≠ A505), S880 (≠ V546), N881 (≠ G547)
- binding fe2/s2 (inorganic) cluster: L717 (≠ V378)
- binding uric acid: E775 (≠ R433), R853 (≠ P511), F887 (≠ V552)
Sites not aligning to the query:
- active site: 1233, 1234
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 113, 145, 147
- binding uric acid: 982, 983, 1051, 1052, 1234
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 47% coverage: 216:573/756 of query aligns to 565:935/1331 of P22985
Sites not aligning to the query:
- 43 binding
- 48 binding
- 51 binding
- 73 binding
- 112 binding
- 115 binding
- 147 binding
- 149 binding
- 256:263 binding
- 335:336 WF→AL: Converts the enzyme to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- 346:350 binding
- 359 binding
- 403 binding
- 535 C→A: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with R-992. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with R-992 and S-1316.
- 992 C→R: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with A-535. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and S-1316.
- 1316 C→S: Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and R-992.
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
28% identity, 48% coverage: 220:580/756 of query aligns to 4:381/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
25% identity, 47% coverage: 216:573/756 of query aligns to 538:908/1295 of 6a7xA
- active site: Q740 (= Q399), E775 (≠ R433), R853 (≠ P511), H857 (≠ A523), R885 (= R550)
- binding bicarbonate ion: R812 (= R470), H813 (≠ P471), I850 (≠ Y508), A883 (vs. gap), F884 (≠ W549), F887 (≠ V552), G888 (= G553), Q891 (≠ H556)
- binding uric acid: E775 (≠ R433), R853 (≠ P511), F887 (≠ V552)
Sites not aligning to the query:
- active site: 1233, 1234
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 314, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 329, 365, 366, 432, 433, 473, 480
- binding uric acid: 982, 983, 1052, 1234
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
28% identity, 48% coverage: 220:580/756 of query aligns to 3:380/420 of 3hrdE
- active site: Q207 (= Q399), L242 (= L434), R318 (≠ I515), H322 (≠ T519), R350 (= R550)
- binding calcium ion: T206 (= T398), N208 (≠ M400), D212 (≠ A404), K241 (≠ R433), L242 (= L434), D243 (≠ E435)
- binding pterin cytosine dinucleotide: G237 (≠ A429), F238 (= F430), R350 (= R550)
- binding selenium atom: F238 (= F430), A348 (≠ F548), F349 (≠ W549), R350 (= R550)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
28% identity, 48% coverage: 220:580/756 of query aligns to 3:380/420 of 3hrdA
- active site: Q207 (= Q399), L242 (= L434), R318 (≠ I515), H322 (≠ T519), R350 (= R550)
- binding pterin cytosine dinucleotide: G236 (= G428), G237 (≠ A429), F238 (= F430), R350 (= R550)
- binding magnesium ion: T206 (= T398), N208 (≠ M400), D212 (≠ A404), K241 (≠ R433), L242 (= L434), D243 (≠ E435), T305 (≠ E502), Y308 (≠ A505), A309 (≠ R506), S346 (vs. gap)
- binding nicotinic acid: A314 (≠ P511), R318 (≠ I515), F352 (≠ V552)
- binding selenium atom: F238 (= F430), G239 (= G431), A348 (≠ F548), F349 (≠ W549), R350 (= R550)
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
25% identity, 47% coverage: 216:573/756 of query aligns to 536:906/1291 of 6a7xB
- active site: Q738 (= Q399), E773 (≠ R433), R851 (≠ P511), H855 (≠ A523), R883 (= R550)
- binding bicarbonate ion: R810 (= R470), H811 (≠ P471), T880 (≠ F548), A881 (vs. gap), F885 (≠ V552), G886 (= G553), Q889 (≠ H556)
- binding fe2/s2 (inorganic) cluster: L715 (≠ V378)
- binding uric acid: E773 (≠ R433), R851 (≠ P511), F885 (≠ V552)
Sites not aligning to the query:
- active site: 1231, 1232
- binding flavin-adenine dinucleotide: 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 312, 317, 320, 321, 323, 324, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 428, 430, 431, 471, 478
- binding uric acid: 980, 981, 1049, 1050, 1232
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
25% identity, 47% coverage: 216:573/756 of query aligns to 536:906/1286 of 4yswA
- active site: Q738 (= Q399), E773 (≠ R433), R851 (≠ P511), H855 (≠ A523), R883 (= R550)
- binding bicarbonate ion: R810 (= R470), H811 (≠ P471), I848 (≠ Y508), T880 (≠ F548), A881 (vs. gap), F882 (≠ W549), F885 (≠ V552), G886 (= G553), Q889 (≠ H556)
- binding calcium ion: G838 (≠ A498), T841 (≠ P501), E842 (= E502), S845 (≠ A505), S878 (≠ V546), N879 (≠ G547)
- binding fe2/s2 (inorganic) cluster: L715 (≠ V378)
- binding uric acid: E773 (≠ R433), R851 (≠ P511), F885 (≠ V552)
Sites not aligning to the query:
- active site: 1231, 1232
- binding flavin-adenine dinucleotide: 44, 226, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 312, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374, 399
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 113, 145, 147
- binding 1,4-dihydronicotinamide adenine dinucleotide: 233, 326, 327, 328, 363, 364, 400, 401, 428, 430, 431, 471, 478, 1196
- binding uric acid: 980, 981, 1050, 1232
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
24% identity, 47% coverage: 224:580/756 of query aligns to 7:374/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
8emtB Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
26% identity, 47% coverage: 224:580/756 of query aligns to 488:836/1221 of 8emtB
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 210, 211, 213, 214, 216, 217, 218, 291, 292, 300, 304, 305, 307, 314
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 69, 109, 112, 144, 146
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 50% coverage: 201:576/756 of query aligns to 570:967/1361 of Q8GUQ8
- E831 (≠ R433) mutation to A: Loss of activity.
- R909 (≠ G522) mutation to A: Decreases activity 12-fold.
Sites not aligning to the query:
- 364 W→A: Decreases activity 8-fold.
- 421 Y→A: Decreases activity 4-fold.
- 1297 E→A: Decreases activity 40-fold.
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
26% identity, 48% coverage: 221:580/756 of query aligns to 15:380/731 of 5g5gC
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
4uhxA Human aldehyde oxidase in complex with phthalazine and thioridazine (see paper)
26% identity, 47% coverage: 224:580/756 of query aligns to 545:905/1290 of 4uhxA
Sites not aligning to the query:
- active site: 1223, 1224
- binding flavin-adenine dinucleotide: 43, 44, 229, 230, 231, 232, 233, 234, 235, 236, 237, 310, 311, 319, 320, 323, 324, 326, 329, 332, 333, 377, 404
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 111, 112, 114, 146, 148
- binding 10-{2-[(2S)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020, 1079
- binding 10-{2-[(2R)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
26% identity, 48% coverage: 221:580/756 of query aligns to 15:380/732 of P77489
Sites not aligning to the query:
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
8emtA Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
24% identity, 53% coverage: 182:580/756 of query aligns to 459:869/1254 of 8emtA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 215, 216, 217, 218, 219, 221, 222, 223, 296, 297, 306, 309, 310, 312, 319
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 45, 46, 49, 69, 71, 111, 112, 114, 146, 148
3amzA Bovine xanthine oxidoreductase urate bound form (see paper)
24% identity, 46% coverage: 224:573/756 of query aligns to 537:899/1291 of 3amzA
- active site: Q731 (= Q399), E766 (≠ R433), R844 (≠ G522), H848 (vs. gap), R876 (= R550)
- binding bicarbonate ion: R803 (= R470), H804 (≠ P471), T873 (≠ F548), A874 (vs. gap), F878 (≠ V552), G879 (= G553), Q882 (≠ H556)
- binding calcium ion: A831 (= A498), S834 (≠ P511), R835 (= R512), S838 (≠ D516), S871 (≠ V546), N872 (≠ G547)
- binding fe2/s2 (inorganic) cluster: L708 (≠ V378)
- binding uric acid: E766 (≠ R433), R844 (≠ G522), F878 (≠ V552)
Sites not aligning to the query:
- active site: 1224, 1225
- binding flavin-adenine dinucleotide: 44, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding 1,4-dihydronicotinamide adenine dinucleotide: 328, 329, 330, 365, 366, 402, 403, 430, 432, 433, 473, 480, 1189
- binding uric acid: 973, 974, 1043, 1225
1vdvA Bovine milk xanthine dehydrogenase y-700 bound form (see paper)
24% identity, 46% coverage: 224:573/756 of query aligns to 540:902/1299 of 1vdvA
- active site: Q734 (= Q399), E769 (≠ R433), R847 (≠ G522), H851 (vs. gap), R879 (= R550)
- binding calcium ion: H708 (= H375), Y710 (≠ A377), T803 (≠ D467), G804 (≠ F468), A834 (= A498), S837 (≠ P511), R838 (= R512), S841 (≠ D516), S874 (≠ V546), N875 (≠ G547)
- binding fe2/s2 (inorganic) cluster: L711 (≠ V378)
- binding 1-[3-cyano-4-(neopentyloxy)phenyl]-1h-pyrazole-4-carboxylic acid: E769 (≠ R433), L840 (≠ I515), S843 (≠ T518), R847 (≠ G522), F881 (≠ V552)
Sites not aligning to the query:
- active site: 1227, 1228
- binding flavin-adenine dinucleotide: 43, 44, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding 1-[3-cyano-4-(neopentyloxy)phenyl]-1h-pyrazole-4-carboxylic acid: 976, 977, 978, 981, 1043, 1046
1v97A Crystal structure of bovine milk xanthine dehydrogenase fyx-051 bound form (see paper)
24% identity, 46% coverage: 224:573/756 of query aligns to 539:901/1298 of 1v97A
- active site: Q733 (= Q399), E768 (≠ R433), R846 (≠ G522), H850 (vs. gap), R878 (= R550)
- binding calcium ion: A833 (= A498), S836 (≠ P511), R837 (= R512), S840 (≠ D516), S873 (≠ V546), N874 (≠ G547)
- binding fe2/s2 (inorganic) cluster: L710 (≠ V378)
- binding 4-(5-pyridin-4-yl-1h-1,2,4-triazol-3-yl)pyridine-2-carbonitrile: E768 (≠ R433), L839 (≠ I515), R846 (≠ G522), F880 (≠ V552)
Sites not aligning to the query:
- active site: 1226, 1227
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding 4-(5-pyridin-4-yl-1h-1,2,4-triazol-3-yl)pyridine-2-carbonitrile: 975, 980, 1042, 1044, 1045, 1227
1fo4A Crystal structure of xanthine dehydrogenase isolated from bovine milk (see paper)
24% identity, 46% coverage: 224:573/756 of query aligns to 540:902/1299 of 1fo4A
Sites not aligning to the query:
- active site: 1227, 1228
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 147, 148
Query Sequence
>BPHYT_RS32805 FitnessBrowser__BFirm:BPHYT_RS32805
MLKRRTFLLGGAGAVGALVVGWSVLPPGQRLTTSMPLPAQGSQVALNGWVKIAADNSVTI
MMCKAEMGQGIHTGLAMLLAEELDADWSQVRVEDSPIDKIYNSVQSIIDDLPFRPDDDST
VKRTTVWMTRKLVREAGTMMTGGSSSINDLWTPMREAGASARAMLIGAAAAQWKVPPGEC
RAEGGQVLHPSGHKASFGELSSMAAQQALPRKVTLKDPANFKLIGKPLRRIEAASKINGT
ARFGIDVLPDGLLYASVEMCPTLGGSVAKFDATAAGKMPGFIKAFAVAPYNGGTGGVAVI
ADNPFRAMNAVAAVDVTWHDGPAAKLSNADADRRLAQALDDNDGHAYYHLGDVDAALTRA
ARTVSAEYRAPYLAHGAVEPLNCTVQVADGAATVWVSTQMPGLARHHVAKVLDLDADKVD
VQTFLLGGAFGRRLELDFIAQAAAIAREGGGRPVQTLWSRAQDFTHDFYRPACLSRLKAG
FDNDGKLVAWQAASASQAIVPEALARYYGAPRLPIDKTTCEGAFDQPYEWPAARVAHKIV
ELPVPVGFWRSVGHSHQAFFTEGFTDELAVATGKDPIAFRAALLEQHPRHLAVLKRAAAL
SDWEHPLTHAADGAPRARGVALHEAFGSVVAQVAEVSIGPGKKIRVHRVVCVIDCGIPVN
PNLIRQQMESAVVFGLSAALQDEITLVNGQVQQKNFLDFPVVRIDDCPVIDTDIMPSQLH
PQGVGEAGVPPVAPAVANAVFKLTGQRLRSLPLKLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory