Comparing BPHYT_RS32815 FitnessBrowser__BFirm:BPHYT_RS32815 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
46% identity, 98% coverage: 3:509/519 of query aligns to 2:497/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 43% coverage: 5:227/519 of query aligns to 2:217/241 of 4u00A
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 47% coverage: 2:243/519 of query aligns to 1:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 47% coverage: 2:244/519 of query aligns to 1:254/254 of 1g6hA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 42% coverage: 5:221/519 of query aligns to 1:217/343 of P30750
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 42% coverage: 5:222/519 of query aligns to 17:225/378 of P69874
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 42% coverage: 5:221/519 of query aligns to 2:218/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 42% coverage: 5:221/519 of query aligns to 2:218/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 42% coverage: 5:221/519 of query aligns to 2:218/344 of 3tuiC
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
32% identity, 44% coverage: 3:228/519 of query aligns to 2:226/650 of 5ws4A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 48% coverage: 4:251/519 of query aligns to 2:243/369 of P19566
Sites not aligning to the query:
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
27% identity, 47% coverage: 4:246/519 of query aligns to 1:238/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
27% identity, 47% coverage: 4:246/519 of query aligns to 1:238/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
27% identity, 47% coverage: 4:247/519 of query aligns to 2:240/241 of 6mbnA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
27% identity, 46% coverage: 4:243/519 of query aligns to 1:235/235 of 6mhzA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
28% identity, 43% coverage: 4:225/519 of query aligns to 1:216/233 of 6b8bA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
28% identity, 43% coverage: 4:225/519 of query aligns to 1:216/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
28% identity, 43% coverage: 4:225/519 of query aligns to 1:216/234 of 4p31A
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
30% identity, 42% coverage: 5:221/519 of query aligns to 4691:4907/5034 of Q5SSE9
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 43% coverage: 261:485/519 of query aligns to 2:214/240 of 6mjpA
>BPHYT_RS32815 FitnessBrowser__BFirm:BPHYT_RS32815
MTQALMTMRGIVKAFSGVKALDGIDLTVAPGECVGLCGENGAGKSTLMKVLSGVYPWGTW
DGEIIWEGEPLKAASVRDTERAGIIIIHQELMLVPELSVAENIFLGNEITLPGGRMNYAA
MYQRADELLRELGISGINAAQPVMNYGGGHQQLIEIAKALNKRAKLLILDEPSSSLTSSE
IRILLDIVRDLKRRGVACVYISHKLDEVAAVCDTISVIRDGRHVATEPMRALTTDRIISL
MVGREIKNLFPREPHPIGDVIFEARHVTCFDVTNPRRKRVNDVSFGLRHGEILGVAGLVG
AGRTELMQAIFGAYPGVSEATVVMDGKPLKIRAPVDAIRAGIGMVPEDRKRHGIVPGLSV
GHNITLAVLQRFASGGRIDSAAELDTINTEMKRLSVRAAHPMLSIASLSGGNQQKAVLTR
MLLTNPKVLILDEPTRGVDVGAKYEIYKLIFQLAQRGMSIVMVSSELPEVLGISDRVLVI
GEGELRGDFVNDGLTQEDILSAAIRPVQRSPNPTAASAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory