SitesBLAST
Comparing BPHYT_RS32905 FitnessBrowser__BFirm:BPHYT_RS32905 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
43% identity, 94% coverage: 22:457/463 of query aligns to 25:459/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R330), T337 (≠ G334), K348 (≠ A345), Y379 (≠ F378), H381 (= H380), H388 (= H387), H423 (= H421)
- binding flavin-adenine dinucleotide: W39 (= W36), P75 (≠ V72), Q76 (= Q73), G77 (= G74), G78 (= G75), N79 (≠ L76), T80 (= T77), G81 (= G78), M82 (≠ L79), G85 (= G82), S86 (≠ A83), L139 (= L136), G140 (= G137), A141 (= A138), C145 (= C142), G149 (= G146), N150 (= N147), A152 (= A149), T153 (= T150), G157 (= G154), G207 (= G204), I212 (= I209), E422 (= E420), N459 (= N457)
- binding zinc ion: H381 (= H380), H388 (= H387), E422 (= E420)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
43% identity, 94% coverage: 22:457/463 of query aligns to 25:459/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (= W36), P75 (≠ V72), G77 (= G74), G78 (= G75), N79 (≠ L76), T80 (= T77), G81 (= G78), G85 (= G82), S86 (≠ A83), L139 (= L136), G140 (= G137), A141 (= A138), C145 (= C142), H146 (≠ Q143), G148 (= G145), G149 (= G146), N150 (= N147), A152 (= A149), T153 (= T150), A155 (= A152), E206 (= E203), G207 (= G204), I211 (≠ V208), I212 (= I209), E422 (= E420), N459 (= N457)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R330), T337 (≠ G334), K348 (≠ A345), Y379 (≠ F378), H381 (= H380), H388 (= H387), H423 (= H421)
- binding zinc ion: H381 (= H380), H388 (= H387), E422 (= E420)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
43% identity, 94% coverage: 22:457/463 of query aligns to 25:459/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (= W36), P75 (≠ V72), G77 (= G74), G78 (= G75), N79 (≠ L76), T80 (= T77), G81 (= G78), G85 (= G82), S86 (≠ A83), L139 (= L136), G140 (= G137), A141 (= A138), C145 (= C142), H146 (≠ Q143), G149 (= G146), N150 (= N147), A152 (= A149), T153 (= T150), A155 (= A152), G157 (= G154), E206 (= E203), G207 (= G204), I211 (≠ V208), I212 (= I209), E422 (= E420), N459 (= N457)
- binding d-malate: M82 (≠ L79), R333 (= R330), T337 (≠ G334), K348 (≠ A345), Y379 (≠ F378), H381 (= H380), H388 (= H387), E422 (= E420), H423 (= H421)
- binding zinc ion: H381 (= H380), H388 (= H387), E422 (= E420)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
43% identity, 94% coverage: 22:457/463 of query aligns to 25:459/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R330), T337 (≠ G334), K348 (≠ A345), Y379 (≠ F378), H381 (= H380), H388 (= H387), N390 (≠ L389), H423 (= H421)
- binding flavin-adenine dinucleotide: W39 (= W36), P75 (≠ V72), G77 (= G74), G78 (= G75), N79 (≠ L76), T80 (= T77), G81 (= G78), M82 (≠ L79), G85 (= G82), S86 (≠ A83), L139 (= L136), G140 (= G137), A141 (= A138), C145 (= C142), G149 (= G146), N150 (= N147), A152 (= A149), T153 (= T150), A155 (= A152), G157 (= G154), G207 (= G204), I212 (= I209), E422 (= E420), H423 (= H421)
- binding zinc ion: H381 (= H380), H388 (= H387), E422 (= E420)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
43% identity, 94% coverage: 22:457/463 of query aligns to 26:460/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (= W36), P76 (≠ V72), G78 (= G74), G79 (= G75), N80 (≠ L76), T81 (= T77), G82 (= G78), M83 (≠ L79), G86 (= G82), S87 (≠ A83), L140 (= L136), A142 (= A138), C146 (= C142), H147 (≠ Q143), G150 (= G146), N151 (= N147), A153 (= A149), T154 (= T150), G208 (= G204), I212 (≠ V208), I213 (= I209), E423 (= E420), N460 (= N457)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
43% identity, 94% coverage: 22:457/463 of query aligns to 78:512/521 of Q8N465
- S109 (≠ P53) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V71) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G75) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ A91) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ V97) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V116) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P133) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A149) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ P175) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G177) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S319) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R330) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ G334) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ H343) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ A345) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (= R363) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ Q373) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H380) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G382) to V: slight reduction in catalytic activity
- N439 (= N385) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H387) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ L389) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ S390) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ P392) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E420) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H421) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G422) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
42% identity, 94% coverage: 30:462/463 of query aligns to 27:465/465 of 3pm9A
- active site: A149 (= A152), L159 (≠ T162)
- binding flavin-adenine dinucleotide: P69 (≠ V72), Q70 (= Q73), G71 (= G74), G72 (= G75), N73 (≠ L76), T74 (= T77), G75 (= G78), L76 (= L79), G79 (= G82), Q80 (≠ A83), L91 (= L94), L133 (= L136), G134 (= G137), A135 (= A138), C139 (= C142), T140 (≠ Q143), G142 (= G145), G143 (= G146), S146 (≠ A149), T147 (= T150), A149 (= A152), G150 (= G153), E200 (= E203), G201 (= G204), I205 (≠ V208), I206 (= I209), E423 (= E420)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
34% identity, 91% coverage: 35:457/463 of query aligns to 59:491/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
31% identity, 98% coverage: 12:463/463 of query aligns to 13:465/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (= V72), G75 (= G74), S76 (≠ G75), G77 (≠ L76), T78 (= T77), G79 (= G78), L80 (= L79), A83 (≠ G82), C84 (≠ A83), P137 (≠ L136), G138 (= G137), E139 (≠ A138), A142 (≠ C142), T143 (≠ Q143), G146 (= G146), N147 (= N147), S149 (≠ A149), T150 (= T150), A152 (= A152), G153 (= G153), E203 (= E203), G204 (= G204), I209 (= I209), E422 (= E420), H423 (= H421)
- binding fe (iii) ion: H377 (= H380), H384 (= H387), E422 (= E420)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
30% identity, 97% coverage: 12:461/463 of query aligns to 8:453/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R330), W322 (≠ G334), H369 (= H380), H376 (= H387), H413 (= H421)
- binding flavin-adenine dinucleotide: E32 (≠ W36), P68 (≠ V72), G70 (= G74), T71 (≠ G75), G72 (≠ L76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L94), P132 (≠ L136), G133 (= G137), A134 (= A138), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), W322 (≠ G334), E412 (= E420), H413 (= H421), N449 (= N457)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E412 (= E420)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
30% identity, 97% coverage: 12:461/463 of query aligns to 8:453/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R330), W322 (≠ G334), S336 (≠ A345), H369 (= H380), H376 (= H387), H413 (= H421)
- binding flavin-adenine dinucleotide: P68 (≠ V72), G70 (= G74), T71 (≠ G75), G72 (≠ L76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L94), P132 (≠ L136), G133 (= G137), A134 (= A138), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), E412 (= E420), N449 (= N457)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E412 (= E420)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
30% identity, 97% coverage: 12:461/463 of query aligns to 8:453/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L79), R317 (= R330), W321 (≠ G334), H368 (= H380), H375 (= H387), H413 (= H421)
- binding flavin-adenine dinucleotide: P68 (≠ V72), G70 (= G74), T71 (≠ G75), G72 (≠ L76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L94), P132 (≠ L136), G133 (= G137), A134 (= A138), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), W321 (≠ G334), Y322 (≠ E335), E412 (= E420), H413 (= H421), N449 (= N457)
- binding manganese (ii) ion: H368 (= H380), H375 (= H387), E412 (= E420)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
30% identity, 97% coverage: 12:461/463 of query aligns to 8:455/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ W36), P68 (≠ V72), G70 (= G74), T71 (≠ G75), G72 (≠ L76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L94), P132 (≠ L136), G133 (= G137), A134 (= A138), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), W323 (≠ G334), E414 (= E420), H415 (= H421), N451 (= N457)
- binding manganese (ii) ion: H370 (= H380), H377 (= H387), E414 (= E420)
- binding pyruvic acid: R319 (= R330), H370 (= H380), H377 (= H387), H415 (= H421)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
30% identity, 97% coverage: 12:461/463 of query aligns to 8:454/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ W36), P68 (≠ V72), G70 (= G74), T71 (≠ G75), G72 (≠ L76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L94), P132 (≠ L136), G133 (= G137), A134 (= A138), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), W322 (≠ G334), E413 (= E420), H414 (= H421), N450 (= N457)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R330), H369 (= H380), H376 (= H387), H414 (= H421)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E413 (= E420)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
30% identity, 97% coverage: 12:461/463 of query aligns to 8:454/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (≠ V72), G70 (= G74), T71 (≠ G75), G72 (≠ L76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L94), P132 (≠ L136), G133 (= G137), A134 (= A138), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), H369 (= H380), E413 (= E420), N450 (= N457)
- binding deaminohydroxyvaline: R319 (= R330), H414 (= H421)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
30% identity, 97% coverage: 12:461/463 of query aligns to 8:454/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R330), W322 (≠ G334), H369 (= H380), H376 (= H387), H414 (= H421)
- binding flavin-adenine dinucleotide: P68 (≠ V72), G70 (= G74), T71 (≠ G75), G72 (≠ L76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L94), P132 (≠ L136), G133 (= G137), A134 (= A138), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), W322 (≠ G334), E413 (= E420), N450 (= N457)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E413 (= E420)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
30% identity, 97% coverage: 12:461/463 of query aligns to 8:454/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R330), H369 (= H380), H376 (= H387), H414 (= H421)
- binding flavin-adenine dinucleotide: P68 (≠ V72), G70 (= G74), T71 (≠ G75), G72 (≠ L76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L94), P132 (≠ L136), G133 (= G137), A134 (= A138), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), W322 (≠ G334), E413 (= E420), H414 (= H421), N450 (= N457)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E413 (= E420)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
30% identity, 97% coverage: 12:461/463 of query aligns to 8:454/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (≠ V72), G70 (= G74), T71 (≠ G75), G72 (≠ L76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L94), P132 (≠ L136), G133 (= G137), A134 (= A138), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), W322 (≠ G334), E413 (= E420), H414 (= H421), N450 (= N457)
- binding lactic acid: R318 (= R330), H369 (= H380), H376 (= H387), H414 (= H421)
- binding manganese (ii) ion: H369 (= H380), H376 (= H387), E413 (= E420)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
30% identity, 97% coverage: 12:461/463 of query aligns to 8:455/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (≠ V72), G70 (= G74), T71 (≠ G75), G72 (≠ L76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L94), P132 (≠ L136), G133 (= G137), A134 (= A138), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), Y324 (≠ E335), H370 (= H380), E414 (= E420), N451 (= N457)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R330), W323 (≠ G334), H415 (= H421)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
30% identity, 97% coverage: 12:461/463 of query aligns to 8:455/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R330), W323 (≠ G334), H370 (= H380), H415 (= H421)
- binding flavin-adenine dinucleotide: P68 (≠ V72), G70 (= G74), T71 (≠ G75), G72 (≠ L76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L94), P132 (≠ L136), G133 (= G137), A134 (= A138), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), H370 (= H380), E414 (= E420), N451 (= N457)
Query Sequence
>BPHYT_RS32905 FitnessBrowser__BFirm:BPHYT_RS32905
MHRHDTDALYNALVEILGADCVSLDAAVAEAHAGDWSDAPRMRPRMTLLPRNPEDVARAL
RVLGEHRQAVVVQGGLTGLAGGATPQAGEVALSLARVNAIESFDRIGGTLTVQAGVPLEQ
LQTFVEAEGWFFPLDLGARGTCQIGGNAATNAGGNRVIRFGTMRDLILGLEVALPDGTML
SMMNRVTKNTTGIDLKQLFIGSEGTLGVITRIVLKLEPKPSAVNTALCAVASFDDATRLL
KYLRARLANLSSFELMWQDFMSAAMDIAHLKAPFGDTYPVYVLIETLGESDDDDRRALEH
SLERMLDDGIVQDVIIAQSIEHAKQLWAYRETVGELLSKLKPHAAFDIGIPMDRMNGFVE
DARAALNERFSQQAHLFFGHLGDGNLHLLSGPYADAADLLKVEELIYAAVNDVQGCISAE
HGIGVIKQPFLHYSRSAPELDLMGKLKALLDPAGILNVGRVTK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory