SitesBLAST
Comparing BPHYT_RS32935 FitnessBrowser__BFirm:BPHYT_RS32935 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
46% identity, 99% coverage: 3:248/248 of query aligns to 1:245/245 of 5wuwA
- active site: G16 (= G18), S140 (= S143), Y154 (= Y157), L161 (≠ I164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), R15 (= R17), I17 (= I19), Y36 (= Y38), A37 (≠ S39), A38 (≠ S40), D63 (= D65), S64 (≠ Q66), N90 (= N92), A91 (= A93), G92 (≠ A94), Y154 (= Y157), K158 (= K161), G185 (= G188), P186 (≠ S189), V187 (≠ T190)
5u2wA Crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP
46% identity, 99% coverage: 3:248/248 of query aligns to 2:246/246 of 5u2wA
- active site: G17 (= G18), S141 (= S143), M152 (≠ L154), Y155 (= Y157), K159 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), S15 (= S16), R16 (= R17), G17 (= G18), I18 (= I19), Y37 (= Y38), E38 (≠ S39), K39 (≠ S40), S40 (= S41), A63 (= A64), D64 (= D65), S65 (≠ Q66), N91 (= N92), A92 (= A93), G93 (≠ A94), T139 (≠ I141), Y155 (= Y157), K159 (= K161), P185 (≠ T187), G186 (= G188), T188 (= T190), T190 (= T192), M192 (= M194), N193 (= N195)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
43% identity, 99% coverage: 3:248/248 of query aligns to 1:247/247 of 6j7uA
- active site: G16 (= G18), S142 (= S143), Y156 (= Y157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (= S16), R15 (= R17), I17 (= I19), Y36 (= Y38), V37 (vs. gap), S38 (vs. gap), S41 (= S41), D65 (= D65), S66 (≠ Q66), N92 (= N92), A93 (= A93), G94 (≠ A94), I115 (= I116), G141 (≠ S142), S142 (= S143), Y156 (= Y157), K160 (= K161), P186 (≠ T187), T191 (= T192), M193 (= M194), N194 (= N195)
P39333 Cyclic-di-GMP-binding biofilm dispersal mediator protein from Escherichia coli (strain K12) (see paper)
40% identity, 98% coverage: 5:248/248 of query aligns to 4:237/237 of P39333
- E50 (≠ G56) mutation E->Q,V: Shows higher affinity for cyclic-di-GMP, increases swimming motility and biofilm dispersal. Biofilm formation is almost completely removed.
5z2lK Crystal structure of bdca in complex with NADPH (see paper)
40% identity, 98% coverage: 5:248/248 of query aligns to 3:236/244 of 5z2lK
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S14 (= S16), R15 (= R17), I17 (= I19), Y36 (= Y38), A37 (≠ S39), G38 (≠ S40), S39 (= S41), T57 (≠ A64), D58 (= D65), S59 (≠ Q66), N81 (= N92), A82 (= A93), G83 (≠ A94), I129 (= I141), S131 (= S143), Y145 (= Y157), K149 (= K161), P175 (≠ T187), I178 (≠ T190), T180 (= T192), A182 (≠ M194), N183 (= N195)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
39% identity, 98% coverage: 4:245/248 of query aligns to 2:244/247 of 4jroC
- active site: G16 (= G18), S142 (= S143), Q152 (≠ L154), Y155 (= Y157), K159 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (= S16), R15 (= R17), G16 (= G18), I17 (= I19), N35 (≠ S37), Y36 (= Y38), N37 (≠ S39), G38 (≠ S40), S39 (= S41), N63 (≠ D65), V64 (≠ Q66), N90 (= N92), A91 (= A93), I93 (≠ V95), I113 (= I116), S142 (= S143), Y155 (= Y157), K159 (= K161), P185 (≠ T187), I188 (≠ T190), T190 (= T192)
6ypzAAA Monooxygenase (see paper)
43% identity, 97% coverage: 5:245/248 of query aligns to 3:250/253 of 6ypzAAA
- active site: G16 (= G18), S148 (= S143), Y161 (= Y157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (= S16), R15 (= R17), G16 (= G18), I17 (= I19), H35 (≠ S37), A37 (≠ S39), S38 (= S40), N39 (≠ S41), L64 (≠ Q66), N96 (= N92), A97 (= A93), A98 (= A94), T100 (≠ F96), I146 (= I141), S147 (= S142), S148 (= S143), Y161 (= Y157), K165 (= K161), P191 (≠ T187), G192 (= G188), I193 (≠ S189), T194 (= T190), N196 (≠ T192)
6yq0AAA Monooxygenase (see paper)
43% identity, 97% coverage: 5:245/248 of query aligns to 3:250/254 of 6yq0AAA
- active site: G16 (= G18), S148 (= S143), Y161 (= Y157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (= S16), R15 (= R17), G16 (= G18), I17 (= I19), H35 (≠ S37), A37 (≠ S39), S38 (= S40), N39 (≠ S41), L64 (≠ Q66), N96 (= N92), A97 (= A93), A98 (= A94), T100 (≠ F96), R117 (= R112), I146 (= I141), S147 (= S142), S148 (= S143), Y161 (= Y157), K165 (= K161), P191 (≠ T187), G192 (= G188), I193 (≠ S189), T194 (= T190), N196 (≠ T192)
- binding (3~{R})-8-methoxy-3-methyl-3-oxidanyl-2,4-dihydrobenzo[a]anthracene-1,7,12-trione: T100 (≠ F96), G101 (vs. gap), S148 (= S143), G149 (≠ A144), L150 (= L145), C153 (≠ S149), Q158 (≠ L154), Y161 (= Y157), G192 (= G188), I193 (≠ S189)
Sites not aligning to the query:
6yq3AAA Monooxygenase (see paper)
42% identity, 97% coverage: 5:245/248 of query aligns to 3:248/252 of 6yq3AAA
- active site: G16 (= G18), S146 (= S143), Y159 (= Y157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (= S16), R15 (= R17), G16 (= G18), I17 (= I19), H35 (≠ S37), A37 (≠ S39), S38 (= S40), N39 (≠ S41), L64 (≠ Q66), N96 (= N92), A97 (= A93), A98 (= A94), V119 (≠ I116), I144 (= I141), Y159 (= Y157), K163 (= K161), P189 (≠ T187), G190 (= G188), I191 (≠ S189), T192 (= T190), N194 (≠ T192)
- binding (3~{R})-8-methoxy-3-methyl-3,6-bis(oxidanyl)-2,4-dihydrobenzo[a]anthracene-1,7,12-trione: S146 (= S143), G147 (≠ A144), L148 (= L145), Q156 (≠ L154), Y159 (= Y157), I191 (≠ S189)
Sites not aligning to the query:
7nm8AAA Antimycin pathway standalone ketoreductase, AntM (see paper)
40% identity, 97% coverage: 6:245/248 of query aligns to 5:247/251 of 7nm8AAA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), S15 (= S16), R16 (= R17), G17 (= G18), I18 (= I19), H36 (≠ S37), Y37 (= Y38), G38 (≠ S39), H39 (≠ S40), L65 (vs. gap), N97 (= N92), G99 (≠ A94), S147 (= S143), Y160 (= Y157), K164 (= K161), G191 (= G188), T193 (= T190), T195 (= T192)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
39% identity, 96% coverage: 8:245/248 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G18), S138 (= S143), Q148 (≠ L154), Y151 (= Y157), K155 (= K161)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (= S16), R11 (= R17), I13 (= I19), N31 (≠ S37), Y32 (= Y38), A33 (≠ S39), G34 (≠ S40), S35 (= S41), A58 (= A64), N59 (≠ D65), V60 (≠ Q66), N86 (= N92), A87 (= A93), T109 (≠ I116), S138 (= S143), Y151 (= Y157), K155 (= K161), P181 (≠ T187), G182 (= G188)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
39% identity, 96% coverage: 8:245/248 of query aligns to 5:243/246 of 3osuA
8hfjC Crystal structure of cbar mutant (h162f) in complex with NADP+ and a bulky 1,3-cyclodiketone (see paper)
37% identity, 97% coverage: 5:245/248 of query aligns to 6:258/260 of 8hfjC
- binding 2-methyl-2-[(4-methylphenyl)methyl]cyclopentane-1,3-dione: N144 (≠ A144), T145 (≠ L145), F154 (≠ L154), G189 (≠ S189), V198 (≠ D198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), R18 (= R17), I20 (= I19), Y39 (= Y38), A40 (≠ S39), N41 (≠ S40), S42 (= S41), D66 (= D65), V67 (≠ Q66), N93 (= N92), S94 (≠ A93), L116 (≠ I116), T141 (≠ I141), Y157 (= Y157), K161 (= K161), P187 (≠ T187), T190 (= T190), T192 (= T192), M194 (= M194)
Sites not aligning to the query:
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
37% identity, 97% coverage: 5:245/248 of query aligns to 6:257/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (= S143), N144 (≠ A144), T145 (≠ L145), F153 (≠ L154), Y156 (= Y157), G187 (= G188), M193 (= M194), V197 (≠ D198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), R18 (= R17), I20 (= I19), A40 (≠ S39), N41 (≠ S40), S42 (= S41), D66 (= D65), N93 (= N92), S94 (≠ A93), L116 (≠ I116), T141 (≠ I141), Y156 (= Y157), K160 (= K161), P186 (≠ T187), G187 (= G188), G188 (≠ S189), T189 (= T190), T191 (= T192), M193 (= M194)
Sites not aligning to the query:
7yb2D Crystal structure of anthrol reductase (cbar) in complex with NADP+ and emodin (see paper)
37% identity, 97% coverage: 5:245/248 of query aligns to 10:262/264 of 7yb2D
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: S147 (= S143), Y161 (= Y157), G193 (≠ S189), M198 (= M194), F199 (≠ N195), V202 (≠ D198), S203 (= S199), Y206 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G14), R22 (= R17), G23 (= G18), I24 (= I19), Y43 (= Y38), A44 (≠ S39), N45 (≠ S40), S46 (= S41), D70 (= D65), V71 (≠ Q66), N97 (= N92), S98 (≠ A93), L120 (≠ I116), T145 (≠ I141), S147 (= S143), Y161 (= Y157), K165 (= K161), P191 (≠ T187), G192 (= G188), T194 (= T190), T196 (= T192), M198 (= M194)
3iccA Crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution (see paper)
39% identity, 97% coverage: 5:245/248 of query aligns to 5:252/255 of 3iccA
- active site: G18 (= G18), S148 (= S143), F158 (≠ L154), Y161 (= Y157), K165 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G14), S16 (= S16), R17 (= R17), G18 (= G18), I19 (= I19), H37 (≠ S37), Y38 (= Y38), G39 (≠ S39), L66 (≠ Q66), E67 (≠ A67), N98 (= N92), G100 (≠ A94), I146 (= I141), S148 (= S143), Y161 (= Y157), K165 (= K161), P191 (≠ T187), G192 (= G188), M198 (= M194), N199 (= N195)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
40% identity, 97% coverage: 5:245/248 of query aligns to 4:243/247 of P73574
- A14 (≠ G15) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P152) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K161) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ S189) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ S199) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
4fj0D Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone (see paper)
33% identity, 97% coverage: 5:245/248 of query aligns to 7:259/261 of 4fj0D
- active site: G20 (= G18), S144 (= S143), N145 (≠ A144), H155 (≠ L154), Y158 (= Y157), K162 (= K161), Y203 (vs. gap)
- binding 3,7-dihydroxy-2-phenyl-4H-chromen-4-one: S144 (= S143), N145 (≠ A144), G190 (≠ S189), F196 (≠ N195), S200 (vs. gap), Y203 (vs. gap), A219 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G14), R19 (= R17), G20 (= G18), I21 (= I19), A41 (≠ S39), N42 (≠ S40), S43 (= S41), I68 (≠ Q66), N94 (= N92), S95 (≠ A93), G96 (≠ A94), L117 (≠ I116), T142 (≠ I141), Y158 (= Y157), K162 (= K161), P188 (≠ T187), G189 (= G188), G190 (≠ S189), T191 (= T190), T193 (= T192), M195 (= M194)
4fj1B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and genistein (see paper)
33% identity, 97% coverage: 5:245/248 of query aligns to 5:257/259 of 4fj1B
- active site: G18 (= G18), S142 (= S143), N143 (≠ A144), H153 (≠ L154), Y156 (= Y157), K160 (= K161), Y201 (vs. gap)
- binding genistein: G188 (≠ S189), F194 (≠ N195), S198 (vs. gap), Y201 (vs. gap), I202 (vs. gap), M216 (vs. gap), A217 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G14), R17 (= R17), G18 (= G18), I19 (= I19), A39 (≠ S39), N40 (≠ S40), S41 (= S41), I66 (≠ Q66), N92 (= N92), S93 (≠ A93), G94 (≠ A94), L115 (≠ I116), T140 (≠ I141), S142 (= S143), Y156 (= Y157), K160 (= K161), G187 (= G188), T189 (= T190), T191 (= T192), M193 (= M194)
4fj2B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a (see paper)
33% identity, 97% coverage: 5:245/248 of query aligns to 6:258/260 of 4fj2B
- active site: G19 (= G18), S143 (= S143), N144 (≠ A144), H154 (≠ L154), Y157 (= Y157), K161 (= K161), Y202 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), R18 (= R17), G19 (= G18), I20 (= I19), A40 (≠ S39), N41 (≠ S40), S42 (= S41), I67 (≠ Q66), N93 (= N92), S94 (≠ A93), G95 (≠ A94), L116 (≠ I116), T141 (≠ I141), Y157 (= Y157), K161 (= K161), G188 (= G188), G189 (≠ S189), T190 (= T190), T192 (= T192), M194 (= M194)
- binding 5,7-dihydroxy-3-(4-methoxyphenyl)-4H-chromen-4-one: G189 (≠ S189), F195 (≠ N195), V198 (vs. gap), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), M217 (vs. gap), A218 (vs. gap)
Query Sequence
>BPHYT_RS32935 FitnessBrowser__BFirm:BPHYT_RS32935
MANTLQGKIALVTGGSRGIGAATAIQLAAEGATVALSYSSSEAAAQEVIARIEASGGKAI
ALKADQADAKAVKALIAEVIERLGRIDILVNNAAVFVTGTVAETADTSAFERQVKINYEA
VVTAIREASRVMDSGGRIISISSALAWRSTWPGLADYSATKRAIEGYSKGAARDLGPKGI
TVNVIGTGSTNTEMNPDDSPFAEAQAAATALGRFGRPEEIASVIAFVASPAASFITGAII
PVDGGYSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory