SitesBLAST
Comparing BPHYT_RS33330 BPHYT_RS33330 C4-dicarboxylate ABC transporter to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
31% identity, 92% coverage: 9:407/435 of query aligns to 16:418/425 of O59010
- S65 (≠ T62) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A271) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 271:273) binding
- M311 (≠ L306) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ S309) binding
- V355 (= V350) binding
- D394 (= D383) binding
- M395 (= M384) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R386) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N390) binding
- D405 (≠ N394) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
32% identity, 91% coverage: 9:405/435 of query aligns to 7:407/407 of 2nwwA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
31% identity, 91% coverage: 9:405/435 of query aligns to 8:408/408 of 6bauA
- binding cysteine: S270 (= S273), M303 (≠ L306), T306 (≠ S309), A345 (= A348), G346 (= G349), V347 (= V350), G351 (≠ S354), D386 (= D383), C389 (≠ R386), T390 (= T387), N393 (= N390)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
32% identity, 91% coverage: 9:405/435 of query aligns to 16:416/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ I43), F46 (≠ I43), P75 (≠ T73), L91 (≠ C89), F95 (= F93), L130 (≠ V135), I133 (≠ A138), I159 (≠ V160), Y167 (≠ A168), K196 (= K191), G200 (≠ Y195), I207 (= I202), F210 (= F205), L250 (≠ G245), I262 (≠ L257), M269 (≠ A264), T334 (≠ P329), V335 (≠ L330), G336 (= G331), T340 (≠ M335), L343 (= L338), M399 (≠ A388)
- binding aspartic acid: S277 (= S272), S278 (= S273), T314 (≠ S309), G354 (= G349), A358 (≠ G353), G359 (≠ S354), D394 (= D383), R397 (= R386), T398 (= T387)
- binding sodium ion: Y89 (≠ F87), T92 (≠ A90), S93 (= S91), G306 (= G301), T308 (≠ A303), N310 (= N305), N310 (= N305), M311 (≠ L306), D312 (= D307), S349 (= S344), I350 (≠ K345), T352 (≠ M347), N401 (= N390), V402 (= V391), D405 (≠ N394)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
31% identity, 91% coverage: 9:405/435 of query aligns to 8:408/409 of 6bavA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
32% identity, 91% coverage: 9:405/435 of query aligns to 13:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G66), V83 (= V84), I157 (≠ L161), Y164 (≠ A168), K193 (= K191), T305 (≠ A303), I306 (≠ F304), I347 (≠ K345)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I9), M199 (= M197), S275 (= S273), T311 (≠ S309), G356 (≠ S354), L384 (= L376), D391 (= D383), R394 (= R386)
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
31% identity, 92% coverage: 9:407/435 of query aligns to 7:407/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A271), S265 (= S273), M299 (≠ L306), T302 (≠ S309), T340 (≠ M347), G342 (= G349), V343 (= V350), G347 (≠ S354), D383 (= D383), R386 (= R386), T387 (= T387), N390 (= N390)
- binding decyl-beta-d-maltopyranoside: H23 (= H24), V212 (≠ L220), A216 (≠ G224)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
30% identity, 92% coverage: 9:407/435 of query aligns to 11:415/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K191), G195 (≠ Y195), R282 (= R279)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A271), S272 (= S272), S273 (= S273), M307 (≠ L306), T310 (≠ S309), G353 (≠ R352), A354 (≠ G353), R394 (= R386), T395 (= T387)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
30% identity, 92% coverage: 9:407/435 of query aligns to 12:416/425 of 6zgbA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
30% identity, 92% coverage: 9:407/435 of query aligns to 14:418/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
30% identity, 92% coverage: 9:407/435 of query aligns to 14:418/427 of 5e9sA
- binding aspartic acid: R274 (≠ A271), S275 (= S272), S276 (= S273), T313 (≠ S309), G353 (= G349), V354 (= V350), A357 (≠ G353), G358 (≠ S354), D394 (= D383), R397 (= R386), T398 (= T387)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K191), G198 (≠ Y195), Y202 (≠ L199)
- binding sodium ion: Y87 (≠ F87), T90 (≠ A90), S91 (= S91), S276 (= S273), G305 (= G301), A306 (≠ Y302), T307 (≠ A303), N309 (= N305), N309 (= N305), M310 (≠ L306), D311 (= D307), S348 (= S344), I349 (≠ K345), G350 (= G346), T351 (≠ M347), N401 (= N390), V402 (= V391), D405 (≠ N394)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
30% identity, 91% coverage: 9:405/435 of query aligns to 8:396/396 of 6bmiA
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
30% identity, 96% coverage: 16:433/435 of query aligns to 51:495/532 of O35874
- N201 (= N150) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
27% identity, 91% coverage: 16:412/435 of query aligns to 33:409/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ D75), G89 (≠ R77), G92 (= G80), A95 (≠ S83), V96 (= V84), Y99 (≠ F87), M163 (≠ V160), F167 (≠ V164), F293 (= F296), V297 (≠ L300)
- binding aspartic acid: S268 (= S272), S269 (= S273), T306 (≠ S309), G346 (= G349), I347 (≠ V350), A350 (≠ G353), G351 (≠ S354), D380 (= D383), R383 (= R386), T384 (= T387)
P43007 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Homo sapiens (Human) (see 4 papers)
30% identity, 87% coverage: 33:411/435 of query aligns to 68:484/532 of P43007
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E256 (≠ P187) to K: in SPATCCM; does not affect localization at the cell surface; decreased uptake of L-serine and L-alanine; Vmax is decreased by at least 50% for both substrates; 3-fold increase of affinity for L-serine; 2-fold increase of affinity for L-alanine; dbSNP:rs201278558
- R457 (≠ M384) to W: in SPATCCM; does not affect localization at the cell surface; loss of uptake of L-serine and L-alanine; dbSNP:rs761533681
6x2zA Heaat3-ofs-asp (see paper)
26% identity, 95% coverage: 2:414/435 of query aligns to 2:418/419 of 6x2zA
- binding aspartic acid: S275 (≠ A271), S277 (= S273), T314 (≠ S309), G354 (= G349), V355 (= V350), D388 (= D383), R391 (= R386), T392 (= T387)
- binding sodium ion: Y83 (≠ F87), T86 (≠ A90), T87 (≠ S91), G306 (= G301), A307 (≠ Y302), T308 (≠ A303), I309 (≠ F304), N310 (= N305), N310 (= N305), M311 (≠ L306), M311 (≠ L306), D312 (= D307), S349 (= S344), I350 (≠ K345), G351 (= G346), A352 (≠ M347), N395 (= N390), D399 (≠ N394)
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
26% identity, 95% coverage: 2:414/435 of query aligns to 4:431/433 of 8cv2A
- binding sodium ion: Y85 (≠ F87), T88 (≠ A90), T89 (≠ S91), G319 (= G301), A320 (≠ Y302), N323 (= N305), N323 (= N305), M324 (≠ L306), D325 (= D307), N408 (= N390), D412 (≠ N394)
7nsgA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with hip-b
26% identity, 95% coverage: 2:414/435 of query aligns to 8:428/430 of 7nsgA
- binding (+)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: S287 (= S273), D398 (= D383), R401 (= R386), T402 (= T387), N405 (= N390)
- binding (-)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: P366 (≠ A351), D398 (= D383), R401 (= R386), T402 (= T387)
- binding cholesterol hemisuccinate: I258 (≠ V244), L419 (≠ W404)
6s3qA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with tfb-tboa
26% identity, 95% coverage: 2:414/435 of query aligns to 8:428/430 of 6s3qA
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: S286 (= S272), S287 (= S273), T324 (≠ S309), A358 (≠ S343), G361 (= G346), V365 (= V350), A368 (≠ G353), T372 (≠ V357), D398 (= D383), R401 (= R386), T402 (= T387), N405 (= N390)
- binding cholesterol hemisuccinate: K80 (≠ R78), R84 (= R82)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
27% identity, 91% coverage: 16:412/435 of query aligns to 25:395/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (= L67), S80 (≠ D75), G81 (≠ R77), G84 (= G80), Y91 (≠ F87), M156 (≠ V160), F160 (≠ V164), F286 (= F296), V290 (≠ L300)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V59), I148 (= I152), S262 (= S273), S263 (≠ E274), A292 (≠ Y302), T293 (≠ A303), M296 (≠ L306), T299 (≠ S309), G329 (= G346), A336 (≠ G353), G337 (≠ S354), D366 (= D383), R369 (= R386), N373 (= N390)
Query Sequence
>BPHYT_RS33330 BPHYT_RS33330 C4-dicarboxylate ABC transporter
MKNRLTFYIVAGMALGVIVGYVCHRSAAGAAEAKTIAGYFSIITDIFLRLVKMIIAPLVF
ATLVSGLAGMEGTSDVRRIGFRSVGWFVCASLFSLALGLALANALQPGAGLHMTQTSSDV
ATGLNTAGLNFKDFVTHAFPSSIIDAMARNDILQILVFSVLFGVVLSAIKKDPRVTPLIA
GIDALVPAMLKLTDYVMRLAPIGVFGALASAITVNGLDVLTTYGKLVGSFYLGLVTLWIV
LIFVGYAFLGKSIWRLLKAVREPAMLAFSTASSEAAYPRLTEKLEAFGIDKKVVGFTLPL
GYAFNLDGSMMYQAFAAIFIAQAFGIDMPLGAQIMMLLVLMLSSKGMAGVARGSVVVVAA
IAPMFHLPPSGVVLILAIDQILDMGRTATNVIGNSIATAVIAKWEAKRAVKHIDGADSPA
LGRLQELRELQGETK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory