SitesBLAST
Comparing BPHYT_RS33835 FitnessBrowser__BFirm:BPHYT_RS33835 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WGB5 O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
47% identity, 100% coverage: 1:395/396 of query aligns to 13:406/406 of P9WGB5
- K219 (= K207) modified: N6-(pyridoxal phosphate)lysine
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
47% identity, 93% coverage: 25:394/396 of query aligns to 27:392/396 of 4omaA
- active site: R59 (= R57), Y112 (≠ F110), D184 (= D182), K209 (= K207)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G87 (= G85), I88 (≠ M86), Y112 (≠ F110), D184 (= D182), S206 (= S204), T208 (= T206), K209 (= K207), V337 (≠ G339), S338 (≠ N340), R373 (= R375)
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
47% identity, 93% coverage: 25:394/396 of query aligns to 27:392/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
47% identity, 93% coverage: 25:394/396 of query aligns to 27:392/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
47% identity, 93% coverage: 25:394/396 of query aligns to 27:392/396 of 3jw9A
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
47% identity, 93% coverage: 25:394/396 of query aligns to 26:391/395 of 5m3zA
- active site: R58 (= R57), Y111 (≠ F110), D183 (= D182), K208 (= K207)
- binding norleucine: Y111 (≠ F110), H113 (≠ S112), K208 (= K207), V336 (≠ G339), S337 (≠ N340)
- binding pyridoxal-5'-phosphate: G86 (= G85), I87 (≠ M86), Y111 (≠ F110), E154 (= E153), D183 (= D182), T185 (≠ C184), S205 (= S204), T207 (= T206), K208 (= K207)
- binding 2-[o-phosphonopyridoxyl]-amino-hexanoic acid: G86 (= G85), I87 (≠ M86), Y111 (≠ F110), D183 (= D182), S205 (= S204), T207 (= T206), K208 (= K207), V336 (≠ G339), S337 (≠ N340), R372 (= R375)
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
47% identity, 93% coverage: 25:394/396 of query aligns to 27:392/396 of 4hf8A
- active site: R59 (= R57), Y112 (≠ F110), D184 (= D182), K209 (= K207)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: G87 (= G85), I88 (≠ M86), Y112 (≠ F110), E155 (= E153), N159 (= N157), D184 (= D182), S206 (= S204), K209 (= K207), S338 (≠ N340), R373 (= R375)
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
47% identity, 93% coverage: 25:394/396 of query aligns to 27:392/396 of 6egrA
5dx5A Crystal structure of methionine gamma-lyase from clostridium sporogenes (see paper)
45% identity, 98% coverage: 5:394/396 of query aligns to 6:394/399 of 5dx5A
- active site: R59 (= R57), Y112 (≠ F110), D186 (= D182), K211 (= K207)
- binding pyridoxal-5'-phosphate: Y57 (= Y55), R59 (= R57), S86 (= S84), G87 (= G85), M88 (= M86), Y112 (≠ F110), D186 (= D182), F189 (= F185), S208 (= S204), T210 (= T206), K211 (= K207)
3mkjA Methionine gamma-lyase from citrobacter freundii with pyridoximine-5'- phosphate (see paper)
46% identity, 93% coverage: 25:394/396 of query aligns to 27:381/386 of 3mkjA
- active site: Y101 (≠ F110), D173 (= D182), K198 (= K207)
- binding [5-hydroxy-4-(iminomethyl)-6-methyl-pyridin-3-yl]methyl dihydrogen phosphate: G76 (= G85), I77 (≠ M86), Y101 (≠ F110), E144 (= E153), D173 (= D182), F176 (= F185), S195 (= S204), T197 (= T206), K198 (= K207)
1e5fA Methionine gamma-lyase (mgl) from trichomonas vaginalis
37% identity, 97% coverage: 9:394/396 of query aligns to 7:389/393 of 1e5fA
- active site: R55 (= R57), Y108 (≠ F110), D181 (= D182), K206 (= K207)
- binding pyridoxal-5'-phosphate: Y53 (= Y55), R55 (= R57), G83 (= G85), M84 (= M86), Y108 (≠ F110), D181 (= D182), S203 (= S204), K206 (= K207)
1e5eA Methionine gamma-lyase (mgl) from trichomonas vaginalis in complex with propargylglycine
37% identity, 97% coverage: 9:394/396 of query aligns to 7:389/394 of 1e5eA
- active site: R55 (= R57), Y108 (≠ F110), D181 (= D182), K206 (= K207)
- binding n-(hydroxy{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)norvaline: Y53 (= Y55), R55 (= R57), G83 (= G85), M84 (= M86), Y108 (≠ F110), N155 (= N157), D181 (= D182), S203 (= S204), T205 (= T206), K206 (= K207), S335 (≠ N340), T350 (= T355), R370 (= R375)
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
43% identity, 93% coverage: 28:394/396 of query aligns to 26:380/384 of 4iyoD
- active site: R47 (= R57), Y99 (≠ F110), D172 (= D182), K197 (= K207)
- binding serine: Y45 (= Y55), T48 (≠ F58), Y99 (≠ F110), Y99 (≠ F110), R104 (≠ G115), K197 (= K207), N227 (≠ R236), E325 (≠ G339), S326 (≠ N340), T341 (= T355), R361 (= R375)
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
43% identity, 93% coverage: 28:394/396 of query aligns to 26:380/381 of 4iyoB
- active site: R47 (= R57), Y99 (≠ F110), D172 (= D182), K197 (= K207)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y55), R47 (= R57)
- binding amino-acrylate: Y99 (≠ F110), K197 (= K207), S326 (≠ N340), T341 (= T355), R361 (= R375)
- binding pyruvic acid: Q221 (≠ K230), F224 (≠ P233)
- binding serine: Y45 (= Y55), T48 (≠ F58), Y99 (≠ F110), R104 (≠ G115), N227 (≠ R236), E325 (≠ G339)
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
43% identity, 93% coverage: 28:394/396 of query aligns to 26:380/381 of 4iy7B
- active site: R47 (= R57), Y99 (≠ F110), D172 (= D182), K197 (= K207)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y55), R47 (= R57)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: G75 (= G85), M76 (= M86), Y99 (≠ F110), E143 (= E153), N147 (= N157), D172 (= D182), S194 (= S204), K197 (= K207), S326 (≠ N340), L327 (= L341), T341 (= T355), R361 (= R375)
- binding pyruvic acid: Q221 (≠ K230), F224 (≠ P233)
- binding serine: Y45 (= Y55), T48 (≠ F58), Y99 (≠ F110), R104 (≠ G115), N227 (≠ R236), E325 (≠ G339)
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
43% identity, 93% coverage: 28:394/396 of query aligns to 26:380/381 of 4iy7A
- active site: R47 (= R57), Y99 (≠ F110), D172 (= D182), K197 (= K207)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: G75 (= G85), M76 (= M86), Y99 (≠ F110), E143 (= E153), N147 (= N157), D172 (= D182), S194 (= S204), K197 (= K207), S326 (≠ N340), L327 (= L341), T341 (= T355), R361 (= R375)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: Y45 (= Y55), R47 (= R57)
- binding serine: Y45 (= Y55), T48 (≠ F58), Y99 (≠ F110), R104 (≠ G115), N227 (≠ R236), E325 (≠ G339)
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
43% identity, 93% coverage: 28:394/396 of query aligns to 26:380/381 of 4ixzA
3vk3A Crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant complexed with l-methionine (see paper)
38% identity, 98% coverage: 6:394/396 of query aligns to 8:393/397 of 3vk3A
1pg8A Crystal structure of l-methionine alpha-, gamma-lyase
38% identity, 98% coverage: 6:394/396 of query aligns to 9:394/398 of 1pg8A
- active site: R61 (= R57), Y114 (≠ F110), D186 (= D182), K211 (= K207)
- binding pyridoxal-5'-phosphate: Y59 (= Y55), R61 (= R57), S88 (= S84), G89 (= G85), M90 (= M86), Y114 (≠ F110), D186 (= D182), S208 (= S204), T210 (= T206), K211 (= K207)
P13254 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methioninase; EC 4.4.1.11; EC 4.4.1.2 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
38% identity, 98% coverage: 6:394/396 of query aligns to 9:394/398 of P13254
- YSR 59:61 (= YSR 55:57) binding
- R61 (= R57) mutation R->A,E,F: Loss of elimination activity against L-methionine.
- GM 89:90 (= GM 85:86) binding in other chain
- Y114 (≠ F110) binding
- C116 (≠ S112) mutation to H: Drastic decrease of the catalytic efficiency of the elimination reaction with L-methionine, by 6700-fold, and increases that with L-cysteine by 7-fold, mainly due to changes in kcat. Loss of ability to catalyze replacement reaction between L-methionine and 2-mercaptoethanol.; mutation to S: 9% of wild-type elimination activity against L-methionine.; mutation to T: 40% of wild-type elimination activity against L-methionine.
- SAT 208:210 (= SAT 204:206) binding in other chain
- K211 (= K207) modified: N6-(pyridoxal phosphate)lysine
- K240 (≠ R236) mutation K->D,E: Marked decrease in elimination activity against both L-methionine and DL-homocysteine.; mutation to M: 50% reduction in alpha,gamma-elimination activity against DL-homocysteine, while retaining elimination activity against L-methionine and L-cysteine.
- D241 (≠ S237) mutation D->H,R: 5 to 14-fold reduction in alpha,gamma-elimination activity against L-methionine, while no change in affinity for L-methionine.
- R375 (= R375) binding
Query Sequence
>BPHYT_RS33835 FitnessBrowser__BFirm:BPHYT_RS33835
MDDSLNFDTLAVRSGTVRSDFNEHSEAIFLTSSFVFESAADAAEKFKNSEDNYTYSRFTN
PTVSMFQDRLAALEGGEACMATASGMAAIMSVVMSTLQAGDHLVSSQALFGSTLGMFSQI
FSKFGITTTFVDPTDLDAWKNAVRPETKMFFLETPSNPLTEVADIEAISKIANASNALFV
VDNCFCSPALQQPLKLGADVVMHSATKFLDGQGRVLGGALVGSKQFIMEKVFPFVRSAGP
TLSAFNAWVLLKGMETLSLRVEKQSANALEIARWLEAHPAVNRVFYPGLESHPQHALAMR
QQKAGGAILSFELKGDTPEQMRANAWRVIDNTKICSITGNLGDTRTTITHPATTTHGRVT
PEARAAAGISEGLIRLAVGLENAGDIRGDLERGLAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory