Comparing BPHYT_RS33965 FitnessBrowser__BFirm:BPHYT_RS33965 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6s87D Crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in complex with oxaloacetate.
54% identity, 93% coverage: 28:394/395 of query aligns to 2:365/365 of 6s87D
P39120 Citrate synthase 2; Citrate synthase II; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
40% identity, 93% coverage: 28:394/395 of query aligns to 7:371/372 of P39120
O34002 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Antarctic bacterium DS2-3R (see 2 papers)
42% identity, 92% coverage: 21:385/395 of query aligns to 3:375/379 of O34002
Sites not aligning to the query:
1a59A Cold-active citrate synthase (see paper)
42% identity, 92% coverage: 21:385/395 of query aligns to 1:373/377 of 1a59A
1aj8A Citrate synthase from pyrococcus furiosus (see paper)
38% identity, 93% coverage: 28:395/395 of query aligns to 5:371/371 of 1aj8A
1iomA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
35% identity, 93% coverage: 28:394/395 of query aligns to 5:374/374 of 1iomA
1ixeA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
35% identity, 93% coverage: 28:394/395 of query aligns to 5:371/371 of 1ixeA
I6Y9Q3 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
36% identity, 99% coverage: 1:390/395 of query aligns to 5:390/393 of I6Y9Q3
6abyA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
35% identity, 93% coverage: 28:394/395 of query aligns to 7:370/372 of 6abyA
6abxA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with citrate (see paper)
35% identity, 93% coverage: 28:394/395 of query aligns to 7:370/370 of 6abxA
6abwA Crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa (see paper)
36% identity, 91% coverage: 35:394/395 of query aligns to 7:369/369 of 6abwA
2c6xA Structure of bacillus subtilis citrate synthase
32% identity, 91% coverage: 28:386/395 of query aligns to 5:363/363 of 2c6xA
P39119 Citrate synthase 1; Citrate synthase I; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
32% identity, 91% coverage: 28:386/395 of query aligns to 6:364/366 of P39119
4yboB Structure of citrate synthase from the thermoacidophilic euryarchaeon thermolasma acidophilum (see paper)
35% identity, 94% coverage: 25:395/395 of query aligns to 4:381/381 of 4yboB
2ifcC The structure of the binary complex of oxalateacetate with citrate synthase from the thermophilic archaeon thermolasma acidophilum
35% identity, 94% coverage: 25:395/395 of query aligns to 5:382/382 of 2ifcC
2r9eA The structure of the binary complex of citryl dethia coa and citrate synthase from the thermophilic archaeonthermoplasma acidophilum
35% identity, 94% coverage: 25:394/395 of query aligns to 5:381/381 of 2r9eA
2r26A The structure of the ternary complex of carboxymethyl coenzyme a and oxalateacetate with citrate synthase from the thermophilic archaeonthermoplasma acidophilum
35% identity, 94% coverage: 25:394/395 of query aligns to 5:381/381 of 2r26A
P9WPD5 Citrate synthase 1; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 93% coverage: 26:394/395 of query aligns to 47:431/431 of P9WPD5
2h12B Structure of acetobacter aceti citrate synthase complexed with oxaloacetate and carboxymethyldethia coenzyme a (cmx) (see paper)
32% identity, 91% coverage: 34:394/395 of query aligns to 45:426/426 of 2h12B
3msuA Crystal structure of citrate synthase from francisella tularensis
31% identity, 90% coverage: 35:388/395 of query aligns to 56:415/415 of 3msuA
>BPHYT_RS33965 FitnessBrowser__BFirm:BPHYT_RS33965
MSETTQTAGAQGGNEPQSGFKPKKSVALSGVTAGNTALCTVGKTGNDLHYRGYDILDIAS
ACEFEEIAYLLVHEKLPTQAELTAYKIKLKALRGLPANVKAALEWIPAAAHPMDVMRTGV
SVLGTVLPEKDDHNLPGARDIADKLMASLGSMLLYWYHYSHNGKRIEVETDDDSIGGHFL
HLLHGVEPSKEWVDAMHVSLNLYAEHEFNASTFTGRVIAGTGSDIYSAITGAIGALRGPK
HGGANEVAFEIQSRYQTPDEAEADIRKRVENKEVVIGFGHPVYTISDPRNKVIKEIAKKL
SKEAGNSKLFNIAERLESVMWDAKKMFPNLDWFSAVSYHMMGVPTAMFTPLFVIARTAGW
SAHIIEQRIDNKIIRPSANYTGPENLKYLPLNRRK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory