Comparing BPHYT_RS34220 FitnessBrowser__BFirm:BPHYT_RS34220 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
4dlfA Crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group p3221
38% identity, 100% coverage: 1:276/276 of query aligns to 2:286/287 of 4dlfA
O87170 2-pyrone-4,6-dicarboxylate hydrolase; PDC hydrolase; 2-pyrone-4,6-dicarboxylate lactonase; EC 3.1.1.57 from Sphingobium sp. (strain NBRC 103272 / SYK-6) (see paper)
27% identity, 84% coverage: 3:235/276 of query aligns to 26:248/293 of O87170
Sites not aligning to the query:
4di8A Crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 8.5 (see paper)
26% identity, 84% coverage: 3:235/276 of query aligns to 27:249/294 of 4di8A
Sites not aligning to the query:
>BPHYT_RS34220 FitnessBrowser__BFirm:BPHYT_RS34220
MHIDAHQHYWDPARGDYEWLTPELKILYRTFGPEDLKPLRERAGIERTVVVQAAPTIDET
RYLLDLARHEPSIAGVVGWVPLLLPTAPQVIEALAHEPKFKGVRPMLQDLPDDTWIANPD
LTPAIEALIAHDLAFDALIYARHVEPFETFATRFPALRIVVDHGAKPPIRYGRAGYQSWA
DAITRLAQLPHVHCKLSGLVTEASPGWTEETLHPYVEHLLKSFGPARLMWGSDWPVLDLN
GDYLLWHSVANTLLTSLSDAERDAVFGGNAAAFYRL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory