Comparing BPHYT_RS34245 FitnessBrowser__BFirm:BPHYT_RS34245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
35% identity, 92% coverage: 20:489/510 of query aligns to 10:477/501 of P04983
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 41% coverage: 20:229/510 of query aligns to 10:229/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 41% coverage: 20:229/510 of query aligns to 10:229/254 of 1g6hA
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 42% coverage: 14:227/510 of query aligns to 5:222/233 of P75957
7mdyC Lolcde nucleotide-bound
33% identity, 42% coverage: 14:227/510 of query aligns to 2:219/226 of 7mdyC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
33% identity, 42% coverage: 14:227/510 of query aligns to 2:219/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
32% identity, 42% coverage: 14:227/510 of query aligns to 4:221/229 of 7v8iD
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 41% coverage: 19:225/510 of query aligns to 6:211/240 of 4ymuJ
1xefA Crystal structure of the atp/mg2+ bound composite dimer of hlyb-nbd (see paper)
26% identity, 40% coverage: 283:488/510 of query aligns to 20:218/241 of 1xefA
Sites not aligning to the query:
2pmkA Crystal structures of an isolated abc-atpase in complex with tnp-adp (see paper)
25% identity, 40% coverage: 283:488/510 of query aligns to 22:220/243 of 2pmkA
Sites not aligning to the query:
2ff7A The abc-atpase of the abc-transporter hlyb in the adp bound state (see paper)
25% identity, 40% coverage: 283:488/510 of query aligns to 22:220/243 of 2ff7A
Sites not aligning to the query:
7sgrE Structure of hemolysin a secretion system hlyb/d complex (see paper)
26% identity, 40% coverage: 283:488/510 of query aligns to 480:678/700 of 7sgrE
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 42% coverage: 20:235/510 of query aligns to 7:226/343 of P30750
Sites not aligning to the query:
8dckA Structure of hemolysin a secretion system hlyb/d complex, atp-bound (see paper)
26% identity, 40% coverage: 283:488/510 of query aligns to 475:673/691 of 8dckA
Sites not aligning to the query:
3b5jA Crystal structures of the s504a mutant of an isolated abc-atpase in complex with tnp-adp (see paper)
25% identity, 40% coverage: 283:488/510 of query aligns to 22:220/243 of 3b5jA
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
27% identity, 44% coverage: 14:235/510 of query aligns to 2:227/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
27% identity, 44% coverage: 14:235/510 of query aligns to 2:227/344 of 3tuiC
5x40A Structure of a cbio dimer bound with amppcp (see paper)
33% identity, 42% coverage: 12:227/510 of query aligns to 2:217/280 of 5x40A
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
27% identity, 43% coverage: 19:235/510 of query aligns to 7:227/344 of 6cvlD
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
30% identity, 46% coverage: 17:249/510 of query aligns to 5:236/238 of 6s8nB
>BPHYT_RS34245 FitnessBrowser__BFirm:BPHYT_RS34245
MNGQMSELTSSVPVVEALEVTKRFGSTAALNDVSIRVMPGESHALVGRNGAGKSTLVSIL
TGLRKPDTGEVRFSGAAAPSIADRDAWRERVACVYQHSTIIRDLSVAENLFINRQPLRGG
VIDWQAMRRDARALLDHWKIDVREDARAGDLSVEARQLVEIARALSYGARFIILDEPTAQ
LDGDEIKRLFRRISELQREGVTFLFISHHLQEVYEICQAVTVLRDARHIVSAPVSALPRE
QLIEAMTGERGGLAVADAAARGALPADTAVALELKELTGADYEGVSFTVKRGEVVGLTGA
TSSGRTSVAEAIAGLRAAKRGTISVDGAILPPGDVPASLAHGIGCVPKDRHHEGLVLTQS
VAENASMTIARVLGKFGIAAPAKKNAFGQKMIDALGIVAQGPEHVVSGLSGGNQQKVVMA
RALATNPNVLVLIDPTAGVDVKSKEALLSVVDRVREEGKAVLVVSGELDDLRTCDRVLVM
FRGRVAAEFPAGWQDHDLIASVEGVSLHEE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory