Comparing BPHYT_RS34250 FitnessBrowser__BFirm:BPHYT_RS34250 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
28% identity, 75% coverage: 44:306/349 of query aligns to 4:258/271 of 1dbpA
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
26% identity, 69% coverage: 44:283/349 of query aligns to 3:235/274 of 2ioyA
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
28% identity, 74% coverage: 44:303/349 of query aligns to 5:255/270 of 4zjpA
5br1A Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis s4 (avi_5305, target efi-511224) with bound alpha-d-galactosamine (see paper)
26% identity, 86% coverage: 48:346/349 of query aligns to 8:308/320 of 5br1A
4y9tA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis s4 (avi_5305, target efi-511224) with bound alpha-d-glucosamine (see paper)
26% identity, 86% coverage: 48:346/349 of query aligns to 9:309/321 of 4y9tA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
29% identity, 74% coverage: 43:300/349 of query aligns to 10:255/284 of 7e7mC
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
25% identity, 94% coverage: 12:339/349 of query aligns to 2:308/349 of A0QYB5
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
29% identity, 68% coverage: 48:286/349 of query aligns to 8:251/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
29% identity, 68% coverage: 48:286/349 of query aligns to 8:251/288 of 1gudA
Sites not aligning to the query:
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
28% identity, 74% coverage: 48:305/349 of query aligns to 8:270/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
28% identity, 74% coverage: 48:305/349 of query aligns to 8:270/288 of 8wl9A
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
25% identity, 49% coverage: 83:254/349 of query aligns to 42:218/301 of 2x7xA
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
25% identity, 90% coverage: 25:339/349 of query aligns to 22:308/349 of A0QYB3
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
24% identity, 86% coverage: 40:339/349 of query aligns to 1:276/315 of 4rsmA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
24% identity, 70% coverage: 40:283/349 of query aligns to 1:246/287 of 5dteB
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
24% identity, 82% coverage: 53:339/349 of query aligns to 12:275/314 of 5hkoA
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
24% identity, 82% coverage: 53:339/349 of query aligns to 12:275/315 of 4rs3A
Sites not aligning to the query:
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
26% identity, 67% coverage: 51:283/349 of query aligns to 11:238/278 of 6guqA
Sites not aligning to the query:
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
23% identity, 77% coverage: 48:317/349 of query aligns to 12:279/289 of 5hqjA
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
26% identity, 67% coverage: 51:283/349 of query aligns to 16:243/283 of 6gt9A
Sites not aligning to the query:
>BPHYT_RS34250 FitnessBrowser__BFirm:BPHYT_RS34250
MSFAKGPLMARRLFRTSLSVTAAAACFAGLAVSGAAQAADSGKIGLGLPLLTSPFWQSYN
NYLPKYAKESGLDILAPVNSNGDPVQQITDMNNLLNLGAKGIVVGPLDSAAISRALDAAA
AKNVPVVAVDVAPTQGKVAMVVRADNHAYGEKACKYIGEHVKSGKVVQIMGDLASVNGRD
RSEAFRSCLKGYPGLTLLEIPASWKGDVAATALDSLLTANPDVKAIYMQAGGVYLSPTLQ
TLRRKQMLFPAGDAKHVVIVSNDGIPQEFDAIRRGDIDATVSQPADSYAKYGLFYIKAAL
AGQTFKPGPTDHGSNIIQLAPGILEDQLPAPLVTKSNVDDKALWGNTVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory