SitesBLAST
Comparing BPHYT_RS34435 FitnessBrowser__BFirm:BPHYT_RS34435 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
30% identity, 87% coverage: 12:383/427 of query aligns to 16:400/430 of P0AA76
- Y29 (= Y25) binding
- D31 (= D27) mutation to N: Loss of galactonate transport activity.
- R32 (= R28) binding
- Y64 (= Y60) binding
- E118 (= E114) mutation to Q: Loss of galactonate transport activity.
- W358 (= W342) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
30% identity, 87% coverage: 12:383/427 of query aligns to 5:381/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
29% identity, 87% coverage: 12:383/427 of query aligns to 8:365/393 of 6e9oA
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
25% identity, 89% coverage: 39:420/427 of query aligns to 98:493/495 of Q9NRA2
- K136 (= K77) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ T122) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ AQ 137:138) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ -L 202) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ SVLPA 203:207) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (≠ A261) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (≠ V267) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (vs. gap) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
28% identity, 89% coverage: 41:420/427 of query aligns to 75:477/493 of Q03567
Sites not aligning to the query:
- 69 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 89% coverage: 23:401/427 of query aligns to 93:492/582 of Q9JI12
- H128 (≠ F53) mutation to A: Greatly lowers L-glutamate transport.
- R184 (= R107) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E114) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ Y234) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Sites not aligning to the query:
- 88 R→A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
24% identity, 89% coverage: 23:401/427 of query aligns to 35:434/452 of 7t3nA
Sites not aligning to the query:
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 80% coverage: 39:378/427 of query aligns to 98:447/495 of Q5Q0U0
- K136 (= K77) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R107) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ L110) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G111) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E114) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (= G115) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (= F118) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P119) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ T122) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ M125) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ SVLPA 203:207) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (≠ V267) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- G371 (vs. gap) mutation to V: Remains in the endoplasmic reticulum.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
25% identity, 80% coverage: 39:378/427 of query aligns to 98:447/495 of Q8BN82
- H183 (≠ T122) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q9Y2C5 Probable small intestine urate exporter; Solute carrier family 17 member 4 from Homo sapiens (Human) (see 2 papers)
26% identity, 78% coverage: 50:380/427 of query aligns to 111:452/497 of Q9Y2C5
- A372 (≠ S301) to T: in dbSNP:rs11754288
Sites not aligning to the query:
- 66 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
- 75 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-66 and A-90.
- 90 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
25% identity, 63% coverage: 15:283/427 of query aligns to 23:314/452 of Q5EXK5
- D82 (= D72) mutation to A: Loss of activity.
- V311 (≠ I280) mutation to W: Loss of activity.
- D314 (= D283) mutation to A: Loss of activity.
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 44% coverage: 5:193/427 of query aligns to 83:277/534 of P53322
Sites not aligning to the query:
- 283 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
26% identity, 49% coverage: 42:252/427 of query aligns to 45:245/403 of P77589
- D75 (= D72) mutation D->A,E: Lack of 3HPP transport activity.
Sites not aligning to the query:
- 27 E→A: Lack of 3HPP transport activity.; E→D: Slight decrease in 3HPP transport activity.
- 272 A→H: 30% increase in 3HPP transport activity.
- 276 K→D: Lack of 3HPP transport activity.
6zguA Crystal structure of a mfs transporter with bound 3-(2-methylphenyl) propanoic acid at 2.41 angstroem resolution
21% identity, 88% coverage: 41:417/427 of query aligns to 35:400/404 of 6zguA
6zgtA Crystal structure of a mfs transporter with bound 2-naphthoic acid at 2.39 angstroem resolution
21% identity, 88% coverage: 41:417/427 of query aligns to 35:400/404 of 6zgtA
6zgsA Crystal structure of a mfs transporter with bound 3-phenylpropanoic acid at 2.39 angstroem resolution
21% identity, 88% coverage: 41:417/427 of query aligns to 35:400/404 of 6zgsA
Q9GQQ0 Protein spinster; Protein benchwarmer; Protein diphthong from Drosophila melanogaster (Fruit fly) (see paper)
21% identity, 78% coverage: 14:348/427 of query aligns to 117:449/605 of Q9GQQ0
- E217 (= E114) mutation to K: In bnch(N); leads to storage in yolk spheres during oogenesis and results in widespread accumulation of enlarged lysosomal and late endosomal inclusions.
A2SWM2 Sphingosine-1-phosphate transporter SPNS2; Protein spinster homolog 2; Protein two of hearts from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
23% identity, 76% coverage: 23:348/427 of query aligns to 67:399/504 of A2SWM2
- R153 (= R107) mutation to S: In ko157; displays cardia bifida (2 hearts).
6g9xA Crystal structure of a mfs transporter at 2.54 angstroem resolution (see paper)
21% identity, 87% coverage: 45:417/427 of query aligns to 36:392/396 of 6g9xA
6zgrA Crystal structure of a mfs transporter with bound 1- hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution
20% identity, 88% coverage: 43:417/427 of query aligns to 35:395/399 of 6zgrA
Query Sequence
>BPHYT_RS34435 FitnessBrowser__BFirm:BPHYT_RS34435
MKRFRVTSATSIVLVMLCIMYFITYLDRVNVSTAAAGFGKEFHLSHTEVGLVFSAFAYPY
LIFQIIGGWVSDRFGAKRTLIFCGAIWGVATLLTGFAGGLISLLAARVLLGFGEGATFPA
ATSAMARWVAKEKRGFAQGITHAASRIGNAVAPGLIVLVMATWGWRESFYICGVFSLLWV
GVWAITFTEHPKDHPRITNDELSVLPAPKPKAAGVPWSKLFRRMWPVTIVYFCYGWTLWL
FLSWIPQYFLHSYHLQLQKSAIFASVVFFAGVIGDTLGGIVTDWIFTRTGSLKRARSWMV
SVCMFFCLLSLIPLMFTHSLYLSMACLASGFFFAEMTIGPMWAIPMDIAPEYSGTASGMM
NTGSALAAIISPVVGGFLIDYFGSWELPFVGSMLLMAIGVVLAFRMQPESKFALNADKAH
VPTGMGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory