SitesBLAST
Comparing BPHYT_RS34990 FitnessBrowser__BFirm:BPHYT_RS34990 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
38% identity, 96% coverage: 16:420/421 of query aligns to 1:408/422 of P16640
- A15 (= A30) binding
- D37 (= D52) binding
- K50 (= K65) binding
- V83 (≠ A98) binding
- R134 (= R146) binding
- D284 (= D296) binding
- V302 (≠ W314) binding
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
38% identity, 95% coverage: 21:420/421 of query aligns to 5:407/422 of 1q1wA
- active site: L13 (≠ Q29), L44 (≠ R60), P45 (= P61), L305 (≠ Q318)
- binding flavin-adenine dinucleotide: G10 (= G26), G12 (= G28), L13 (≠ Q29), A14 (= A30), G35 (≠ A51), D36 (= D52), L44 (≠ R60), P45 (= P61), K49 (= K65), V82 (≠ A98), A108 (= A124), T109 (= T125), G110 (= G126), R133 (= R146), I159 (= I172), D283 (= D296), S300 (= S313), V301 (≠ W314), W329 (= W342)
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
39% identity, 96% coverage: 16:420/421 of query aligns to 3:396/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (= G28), A15 (= A30), D37 (= D52), E38 (= E53), R45 (= R60), P46 (= P61), K50 (= K65), A79 (= A98), T106 (= T125), G107 (= G126), R127 (= R146), I153 (= I172), G269 (= G295), D270 (= D296), E286 (= E312), T287 (≠ S313), W288 (= W314), A291 (= A317), W317 (= W342)
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
39% identity, 96% coverage: 16:420/421 of query aligns to 1:394/401 of 2gr2A
- active site: L12 (≠ Q29), R43 (= R60), P44 (= P61), Q290 (= Q318)
- binding adenosine-5-diphosphoribose: R109 (= R130), V146 (= V167), G147 (= G168), G149 (= G170), V150 (≠ W171), I151 (= I172), E170 (= E191), T171 (≠ G192), R178 (= R199), G229 (= G257), I230 (= I258), G231 (= G259), E284 (= E312)
- binding flavin-adenine dinucleotide: G11 (= G28), A13 (= A30), D35 (= D52), E36 (= E53), R43 (= R60), P44 (= P61), K48 (= K65), A77 (= A98), T104 (= T125), G105 (= G126), R125 (= R146), G267 (= G295), D268 (= D296), T285 (≠ S313), W286 (= W314), A289 (= A317), W315 (= W342)
2gr0A Crystal structure of ferredoxin reductase, bpha4 (oxidized form, NAD+ complex) (see paper)
39% identity, 96% coverage: 16:420/421 of query aligns to 1:394/401 of 2gr0A
- active site: L12 (≠ Q29), R43 (= R60), P44 (= P61), Q290 (= Q318)
- binding adenosine-5'-diphosphate: V146 (= V167), G147 (= G168), G149 (= G170), I151 (= I172), E170 (= E191), T171 (≠ G192), R178 (= R199), G229 (= G257), I230 (= I258), G231 (= G259)
- binding flavin-adenine dinucleotide: G11 (= G28), A13 (= A30), D35 (= D52), E36 (= E53), R43 (= R60), P44 (= P61), K48 (= K65), T76 (≠ C97), A77 (= A98), T104 (= T125), G105 (= G126), R125 (= R146), I151 (= I172), G267 (= G295), D268 (= D296), E284 (= E312), T285 (≠ S313), W286 (= W314), A289 (= A317), W315 (= W342)
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex (see paper)
39% identity, 96% coverage: 16:420/421 of query aligns to 2:395/402 of 2yvjA
- active site: L13 (≠ Q29), R44 (= R60), P45 (= P61), Q291 (= Q318)
- binding flavin-adenine dinucleotide: G10 (= G26), G12 (= G28), G35 (≠ A51), D36 (= D52), E37 (= E53), R44 (= R60), P45 (= P61), A78 (= A98), T105 (= T125), G106 (= G126), R126 (= R146), G268 (= G295), D269 (= D296), T286 (≠ S313), W287 (= W314), A290 (= A317), W316 (= W342)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (= V167), G148 (= G168), G149 (= G169), G150 (= G170), I152 (= I172), V170 (= V190), E171 (= E191), T172 (≠ G192), R179 (= R199), G230 (= G257), I231 (= I258), G232 (= G259), V233 (≠ L260), E285 (= E312)
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
39% identity, 96% coverage: 16:420/421 of query aligns to 2:395/401 of 1f3pA
- active site: L13 (≠ Q29), R44 (= R60), P45 (= P61), Q291 (= Q318)
- binding flavin-adenine dinucleotide: A14 (= A30), V34 (≠ I50), D36 (= D52), E37 (= E53), R44 (= R60), P45 (= P61), A78 (= A98), T105 (= T125), G106 (= G126), R126 (= R146), G268 (= G295), D269 (= D296), E285 (= E312), T286 (≠ S313), W287 (= W314), A290 (= A317), W316 (= W342)
- binding nicotinamide-adenine-dinucleotide: V147 (= V167), G148 (= G168), G150 (= G170), V151 (≠ W171), I152 (= I172), E155 (= E175), E171 (= E191), T172 (≠ G192), R179 (= R199), G230 (= G257), I231 (= I258), G232 (= G259), V233 (≠ L260), E285 (= E312), W316 (= W342), S317 (= S343)
4h4uA Crystal structure of ferredoxin reductase, bpha4 t176r mutant (reduced form)
39% identity, 96% coverage: 16:420/421 of query aligns to 2:395/401 of 4h4uA
- active site: L13 (≠ Q29), R44 (= R60), P45 (= P61), Q291 (= Q318)
- binding flavin-adenine dinucleotide: G12 (= G28), A14 (= A30), D36 (= D52), R44 (= R60), P45 (= P61), A78 (= A98), T105 (= T125), G106 (= G126), L125 (= L145), R126 (= R146), I152 (= I172), E155 (= E175), G268 (= G295), D269 (= D296), E285 (= E312), T286 (≠ S313), W287 (= W314), A290 (= A317), W316 (= W342)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V151 (≠ W171), I152 (= I172), E171 (= E191), R172 (≠ G192), Q173 (≠ A193), G230 (= G257), I231 (= I258), G232 (= G259), I284 (≠ L311), E285 (= E312), Y315 (≠ F341)
4h4wA Crystal structure of ferredoxin reductase, bpha4 e175c/t176r/q177g mutant (reduced form)
39% identity, 96% coverage: 16:420/421 of query aligns to 1:394/399 of 4h4wA
- active site: L12 (≠ Q29), R43 (= R60), P44 (= P61), Q290 (= Q318)
- binding flavin-adenine dinucleotide: G11 (= G28), A13 (= A30), D35 (= D52), R43 (= R60), P44 (= P61), A77 (= A98), T104 (= T125), G105 (= G126), R125 (= R146), I151 (= I172), E154 (= E175), G267 (= G295), D268 (= D296), T285 (≠ S313), W286 (= W314), A289 (= A317), W315 (= W342)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G148 (= G169), I151 (= I172), R171 (≠ G192), S177 (≠ A198), R178 (= R199), G229 (= G257), I230 (= I258), G231 (= G259)
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
36% identity, 95% coverage: 21:420/421 of query aligns to 3:399/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G26), G10 (= G28), H11 (≠ Q29), A12 (= A30), D34 (= D52), E35 (= E53), R42 (= R60), P43 (= P61), S46 (= S64), K47 (= K65), R78 (≠ C97), M79 (≠ A98), T106 (= T125), R127 (= R146), I153 (= I172), D275 (= D296), S292 (= S313), V293 (≠ W314), W321 (= W342)
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
34% identity, 91% coverage: 38:420/421 of query aligns to 22:404/409 of 3lxdA
- active site: R44 (= R60), P45 (= P61), N302 (≠ Q318)
- binding flavin-adenine dinucleotide: R36 (≠ D52), E37 (= E53), R44 (= R60), P45 (= P61), S48 (= S64), K49 (= K65), E81 (≠ C97), V82 (≠ A98), T109 (= T125), I157 (= I172), G278 (= G295), D279 (= D296), S297 (= S313), V298 (≠ W314), F325 (= F341), W326 (= W342)
Sites not aligning to the query:
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
35% identity, 95% coverage: 22:420/421 of query aligns to 4:397/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G28), V11 (≠ Q29), G12 (≠ A30), D34 (= D52), E35 (= E53), R42 (= R60), P43 (= P61), K47 (= K65), E78 (≠ C97), V79 (≠ A98), T106 (= T125), G107 (= G126), G273 (= G295), D274 (= D296), T290 (≠ S313), Y291 (≠ W314), W319 (= W342)
- binding nicotinamide-adenine-dinucleotide: R111 (= R130), G149 (= G168), L152 (≠ W171), I153 (= I172), E156 (= E175), E172 (= E191), A173 (≠ G192), R180 (= R199), V236 (≠ I258), G237 (= G259), A238 (≠ L260), E289 (= E312), W319 (= W342), T320 (≠ S343)
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
35% identity, 95% coverage: 22:420/421 of query aligns to 5:398/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G28), V12 (≠ Q29), G13 (≠ A30), D35 (= D52), E36 (= E53), R43 (= R60), P44 (= P61), S47 (= S64), K48 (= K65), V80 (≠ A98), T107 (= T125), G108 (= G126), R128 (= R146), G274 (= G295), D275 (= D296), T291 (≠ S313), Y292 (≠ W314), S319 (≠ F341), W320 (= W342)
6tukB Crystal structure of fdr9 (see paper)
33% identity, 95% coverage: 22:421/421 of query aligns to 4:391/393 of 6tukB
- binding flavin-adenine dinucleotide: V7 (≠ I25), G8 (= G26), G9 (= G27), G10 (= G28), A12 (= A30), A34 (≠ D52), E35 (= E53), R42 (= R60), P43 (= P61), K47 (= K65), A75 (≠ C97), A76 (= A98), T102 (= T125), G103 (= G126), V118 (≠ L145), R119 (= R146), G259 (= G295), D260 (= D296), H277 (≠ S313), W278 (= W314), F311 (= F341), W312 (= W342)
Q9LK94 Monodehydroascorbate reductase 4, peroxisomal; AtMDAR4; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
30% identity, 75% coverage: 44:359/421 of query aligns to 30:361/488 of Q9LK94
Sites not aligning to the query:
- 11 G→Q: In sdp2-2; loss of ascorbate recycling.
- 14 V→A: In sdp2-1; loss of ascorbate recycling.
- 386 G→Q: In sdp2-3; loss of ascorbate recycling.
- 483:488 mutation Missing: Loss of peroxisomal targeting.
- 488 mutation Missing: No effect on peroxisomal targeting.
Q9LFA3 Monodehydroascorbate reductase 1, peroxisomal; AtMDAR1; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 82% coverage: 17:362/421 of query aligns to 3:368/434 of Q9LFA3
Sites not aligning to the query:
- 432:434 mutation Missing: Loss of peroxisomal targeting.
5jclA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
29% identity, 76% coverage: 45:362/421 of query aligns to 30:366/429 of 5jclA
- active site: R45 (= R60), P46 (= P61), L61 (= L79), H65 (vs. gap), S70 (vs. gap), R317 (≠ Q318)
- binding flavin-adenine dinucleotide: S36 (≠ A51), K37 (≠ D52), E38 (= E53), R45 (= R60), P46 (= P61), K50 (= K65), I93 (≠ A98), A119 (= A124), T120 (= T125), G121 (= G126), R144 (= R146), E145 (≠ T147), D295 (= D296), E311 (= E312), H312 (≠ S313), V313 (≠ W314), A316 (= A317), Y346 (≠ W342)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G170 (= G170), Y171 (≠ W171), I172 (= I172), E175 (= E175), P192 (≠ G192), R199 (= R199), G256 (= G257), V257 (≠ I258), G258 (= G259), E311 (= E312), H312 (≠ S313), Y346 (≠ W342)
Sites not aligning to the query:
Q652L6 Monodehydroascorbate reductase 3, cytosolic; OsMDAR3; OsMDHAR3; EC 1.6.5.4 from Oryza sativa subsp. japonica (Rice) (see paper)
29% identity, 76% coverage: 45:362/421 of query aligns to 33:369/435 of Q652L6
- E41 (= E53) binding
- R48 (= R60) binding
- K53 (= K65) binding
- C70 (vs. gap) mutation to A: No effect on catalytic activity.; mutation to S: Slight reduction of catalytic activity.
- G72 (vs. gap) mutation to N: Slight reduction of catalytic activity.
- I96 (≠ A98) binding
- RE 147:148 (≠ RT 146:147) binding
- 172:178 (vs. 169:175, 86% identical) binding
- YIGLE 174:178 (≠ WIGLE 171:175) binding
- E196 (≠ A193) binding ; mutation to A: Reduces catalytic activity 2-fold.
- R202 (= R199) binding ; binding
- G261 (= G259) binding ; binding
- D298 (= D296) binding
- EH 314:315 (≠ ES 312:313) binding ; binding
- V316 (≠ W314) binding
- R320 (≠ Q318) binding ; mutation to A: Reduces catalytic activity 5-fold.
- Y349 (≠ W342) binding ; binding ; binding ; mutation Y->A,F,W: Abolishes catalytic activity.
- R351 (≠ D344) binding ; mutation to A: No effect on catalytic activity.
Sites not aligning to the query:
5jciA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
29% identity, 76% coverage: 45:362/421 of query aligns to 30:366/432 of 5jciA
- active site: R45 (= R60), P46 (= P61), L61 (= L79), H65 (vs. gap), S70 (vs. gap), R317 (≠ Q318)
- binding flavin-adenine dinucleotide: S36 (≠ A51), K37 (≠ D52), E38 (= E53), R45 (= R60), P46 (= P61), K50 (= K65), I93 (≠ A98), A119 (= A124), T120 (= T125), G121 (= G126), R144 (= R146), E145 (≠ T147), Y171 (≠ W171), I172 (= I172), L262 (≠ H263), D295 (= D296), H312 (≠ S313), V313 (≠ W314), A316 (= A317), F345 (= F341), Y346 (≠ W342)
Sites not aligning to the query:
5jcnA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
29% identity, 76% coverage: 45:362/421 of query aligns to 30:366/429 of 5jcnA
- active site: R45 (= R60), P46 (= P61), L61 (= L79), H65 (vs. gap), S70 (vs. gap), R317 (≠ Q318)
- binding ascorbic acid: P46 (= P61), G69 (vs. gap), R317 (≠ Q318), F346 (≠ W342)
- binding flavin-adenine dinucleotide: K37 (≠ D52), E38 (= E53), R45 (= R60), P46 (= P61), K50 (= K65), I93 (≠ A98), A119 (= A124), T120 (= T125), R144 (= R146), E145 (≠ T147), L262 (≠ H263), D295 (= D296), E311 (= E312), H312 (≠ S313), V313 (≠ W314), F346 (≠ W342)
- binding nicotinamide-adenine-dinucleotide: G170 (= G170), Y171 (≠ W171), I172 (= I172), P192 (≠ G192), G256 (= G257), V257 (≠ I258), G258 (= G259), E311 (= E312), H312 (≠ S313), F346 (≠ W342)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS34990 FitnessBrowser__BFirm:BPHYT_RS34990
MTDAAAAKAQTAHAGLEAPRTIVVIGGGQAAGWVVKTLRKEGFDGRLVMIADEVHLPYER
PPLSKAVLAGEADIDTVRLVKPDDFEALNVEAWQPDCATSIDREQRIVRTQSGREVQYDR
LVIATGGAARKLPESLVKTSHIAYLRTLDEAVALGERLRASKRVLVVGGGWIGLEVAATA
RKLGVDATVVEGAPRLCARSLPPMVSGFLLDLHRANGVDVRLNASLVSLADHPNDAKRIR
ATFADGSTLDADFAVAGIGLTPHTALAQAAGVKVDDGIVVDHFGATDDPRIFACGDVANH
PSAWLKRRVRLESWANAQNQAIAAAKALLGTFEPYADIPWFWSDQYDVNLQILGDIPGDA
QLAVRGDLPGKRATLFHLEDSAIRGVIAINTPRELKLSRKWMNQGRTIDLATLTDASTAL
A
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory