Comparing BPHYT_RS35090 FitnessBrowser__BFirm:BPHYT_RS35090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
62% identity, 97% coverage: 3:402/413 of query aligns to 11:410/419 of 1ko0A
1knwA Crystal structure of diaminopimelate decarboxylase
62% identity, 97% coverage: 3:402/413 of query aligns to 11:410/421 of 1knwA
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
62% identity, 97% coverage: 3:402/413 of query aligns to 12:411/420 of P00861
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
32% identity, 97% coverage: 10:410/413 of query aligns to 6:399/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
32% identity, 97% coverage: 10:410/413 of query aligns to 4:391/394 of 3c5qA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
34% identity, 95% coverage: 8:401/413 of query aligns to 4:376/386 of Q9X1K5
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
34% identity, 95% coverage: 8:401/413 of query aligns to 3:375/385 of 2yxxA
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
31% identity, 96% coverage: 10:405/413 of query aligns to 20:409/418 of 4xg1B
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
30% identity, 97% coverage: 9:407/413 of query aligns to 22:425/434 of 1tufA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
30% identity, 97% coverage: 9:407/413 of query aligns to 26:429/438 of Q58497
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
29% identity, 97% coverage: 9:407/413 of query aligns to 22:425/434 of 1twiA
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
31% identity, 96% coverage: 10:405/413 of query aligns to 18:384/393 of 4xg1A
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
28% identity, 95% coverage: 18:410/413 of query aligns to 31:420/422 of 6n2aA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
28% identity, 97% coverage: 8:409/413 of query aligns to 32:442/443 of 5x7mA
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
28% identity, 97% coverage: 8:409/413 of query aligns to 32:442/442 of 5x7nA
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
26% identity, 99% coverage: 1:409/413 of query aligns to 1:410/412 of 7ru7A
8d5dA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- arginine (see paper)
28% identity, 99% coverage: 1:409/413 of query aligns to 29:453/458 of 8d5dA
8d88A Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- lysine (see paper)
28% identity, 99% coverage: 1:409/413 of query aligns to 30:457/461 of 8d88A
8d4iA Structure of y430f d-ornithine/d-lysine decarboxylase complex with putrescine (see paper)
28% identity, 99% coverage: 1:409/413 of query aligns to 30:457/462 of 8d4iA
8d5rA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- ornithine (see paper)
28% identity, 99% coverage: 1:409/413 of query aligns to 30:455/461 of 8d5rA
>BPHYT_RS35090 FitnessBrowser__BFirm:BPHYT_RS35090
MPFNPQQLVELAHEHGTPLWVYDADTIRRRIAELRSFDVIRYAQKACSNLHILKLMRDEG
AMVDAVSLGEIKRSLAAGFKPDGDPEGVVFTADLIDHATLATVIEHRITVNAGSLDMLEQ
IGRHAPEGHRVWLRINPGFGHGHSNKTNTGGEHSKHGIWLDDVPRAVELVRRYRLKLVGL
HMHIGSGVDYGHLSRVCEAMVEAVKGLGHDIEAISAGGGLSVPYREGEPDIDVAHYFRLW
DAARRQIETHVGHRVRLEIEPGRFLVAQSGVLVAEVHALNRRPAQQFALLDAGFNDLVRP
SFYGSHHEMTVLRRDGALSEAPIDSFAVAGPLCEAGDVFTQAESGVITNRSIHTPEVGDF
IVFHDAGAYGASMSSNYNSRPLAPEVLLDHGKPRLIRRRQTIDELLALEETAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory